KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0570Help
Entry
NMBM04240196_0570 CDS       T01948                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nmq00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601943..602560
Genome map
AA seq 205 aa AA seqDB search
MSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEANGVHYHFVSK
EEFESLIAQEAFLEYADVFGNYYGTGAEGVNALAAAGYDVILEIDVQGAAQVRDALPEAV
GIFILPPSFDVLAARLNGRGTDSREVIQRRLSKARHEIEQSVLFDFVVVNDDLARAEEDL
RHIVNACRLKRSRQLGFIADLLENS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatcgaaaaggcaacatctttatcatttcggccgcttccggcacgggcaaa
accacgctggtgtcgcggctgttggcaaaccataacggtttgcgcgtttccgtgtcgcac
acgacgcgcccgccgcgtgaaggcgaagcaaacggcgtacattatcactttgtttccaaa
gaagagtttgagtcgcttatcgcgcaggaagcttttttggaatacgccgacgtatttggc
aactattacggcacaggcgcggagggtgtgaatgcgttggcggcggcaggctatgacgtg
attttggaaatcgacgttcagggcgcggcgcaggttcgcgacgcgctgcccgaagccgtc
ggcatctttatcctgccgccttctttcgacgtacttgccgcgcgcctcaacggacgcggg
acggacagtcgggaagttatccaaaggaggctgtcgaaggcaaggcatgaaatcgagcag
tccgtattgtttgactttgtcgtggtcaatgacgacttggcgcgagcggaggaggatttg
cgccatattgtgaatgcctgccgtctgaaaaggtcgcggcaactggggtttattgcagat
ttgttggaaaattcctag

DBGET integrated database retrieval system