KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0646Help
Entry
NMBM04240196_0646 CDS       T01948                                 

Gene name
hisC
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmq01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nmq00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nmq00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:nmq00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nmq00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:nmq00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(684797..685894)
Genome map
AA seq 365 aa AA seqDB search
MKSVRSFIRDDIQAMSAYQIADVPPGFAKLDSMESPVHPFAGHETLLQEWQARLAAAPIH
LYPNPSGSGLQEALRSAFDIPDCADIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMY
RHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEAV
IEASDGIVVVDEAYGAFNGDSFLPQAGRIPNLIVLRTLSKIGFAGLRIGYAAGCPEVIGE
LQKILPPYNMNQLSLTTAKLALRHYGIISANIDSLKNERERMFAELGKICRLNTFPSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIRQLYCQ
PTDFL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtccgctccttcatccgcgacgacatacaagctatgtcggcatatcagatt
gccgacgttccgcccggctttgccaaactcgattcgatggaaagtcccgtccaccctttt
gccggacatgaaacgctgttgcaggaatggcaggcacggcttgccgccgcgcccatccat
ctttaccccaatccctccggcagcggtttacaggaagcattacgttcggcgttcgacatt
cccgactgcgccgacatcgcgctgggcaacggttcggacgaactgatacagttcatcacg
atgctgaccgccaaaccgggcgcggcaatgttggcagccgaacccagtttcgtcatgtac
cgccacaacgccgcgctgtacggcatggattatgtcggcgttccactgaacggagatttc
accctcaacctgcccgccgtcctcgaagccgtcaggaaacaccgccctgccctgaccttt
atcgcctaccccaacaaccccaccggcgtatgcttcacgcgtgccgaaatcgaagccgtc
atcgaagcttcagacggcatcgtcgtcgtcgatgaagcctacggcgcattcaacggcgac
agcttcctgccgcaggcaggcaggattcccaacctgatagtcttacgcaccctcagcaaa
atcggttttgccggactgcgtatcggttatgcggcaggctgccccgaagtcatcggcgaa
ctgcaaaaaatcctgccgccctacaatatgaaccaattgagcctgaccactgccaaactc
gccctgcggcactacggcattatctctgccaacatcgacagcctgaaaaacgaacgcgaa
cggatgttcgccgaattgggcaaaatatgccgtctgaacacctttccaagtcaggcaaac
ttcattaccatacgcgtacccgatgccgatttgttgtttgacacgctcaaacaaaaccgc
atcttggttaaaaaactgcatggcgcgcacccgcttttggaacactgcctgcgcattacc
gtaggcagccccgcacaaaacgatgccgttctcaacatcattcgccaactttactgccaa
ccaacggatttcctatga

DBGET integrated database retrieval system