KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0646Help
Entry
NMBM04240196_0646 CDS       T01948                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00340  Histidine metabolism
nmq00350  Tyrosine metabolism
nmq00360  Phenylalanine metabolism
nmq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmq00401  Novobiocin biosynthesis
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01130  Biosynthesis of antibiotics
nmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NMBM04240196_0646 (hisC)
   00350 Tyrosine metabolism
    NMBM04240196_0646 (hisC)
   00360 Phenylalanine metabolism
    NMBM04240196_0646 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM04240196_0646 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMBM04240196_0646 (hisC)
Enzymes [BR:nmq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     NMBM04240196_0646 (hisC)
Amino acid related enzymes [BR:nmq01007]
 Aminotransferase (transaminase)
  Class II
   NMBM04240196_0646 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADZ01136
Position
complement(684797..685894)
Genome map
AA seq 365 aa AA seqDB search
MKSVRSFIRDDIQAMSAYQIADVPPGFAKLDSMESPVHPFAGHETLLQEWQARLAAAPIH
LYPNPSGSGLQEALRSAFDIPDCADIALGNGSDELIQFITMLTAKPGAAMLAAEPSFVMY
RHNAALYGMDYVGVPLNGDFTLNLPAVLEAVRKHRPALTFIAYPNNPTGVCFTRAEIEAV
IEASDGIVVVDEAYGAFNGDSFLPQAGRIPNLIVLRTLSKIGFAGLRIGYAAGCPEVIGE
LQKILPPYNMNQLSLTTAKLALRHYGIISANIDSLKNERERMFAELGKICRLNTFPSQAN
FITIRVPDADLLFDTLKQNRILVKKLHGAHPLLEHCLRITVGSPAQNDAVLNIIRQLYCQ
PTDFL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtccgctccttcatccgcgacgacatacaagctatgtcggcatatcagatt
gccgacgttccgcccggctttgccaaactcgattcgatggaaagtcccgtccaccctttt
gccggacatgaaacgctgttgcaggaatggcaggcacggcttgccgccgcgcccatccat
ctttaccccaatccctccggcagcggtttacaggaagcattacgttcggcgttcgacatt
cccgactgcgccgacatcgcgctgggcaacggttcggacgaactgatacagttcatcacg
atgctgaccgccaaaccgggcgcggcaatgttggcagccgaacccagtttcgtcatgtac
cgccacaacgccgcgctgtacggcatggattatgtcggcgttccactgaacggagatttc
accctcaacctgcccgccgtcctcgaagccgtcaggaaacaccgccctgccctgaccttt
atcgcctaccccaacaaccccaccggcgtatgcttcacgcgtgccgaaatcgaagccgtc
atcgaagcttcagacggcatcgtcgtcgtcgatgaagcctacggcgcattcaacggcgac
agcttcctgccgcaggcaggcaggattcccaacctgatagtcttacgcaccctcagcaaa
atcggttttgccggactgcgtatcggttatgcggcaggctgccccgaagtcatcggcgaa
ctgcaaaaaatcctgccgccctacaatatgaaccaattgagcctgaccactgccaaactc
gccctgcggcactacggcattatctctgccaacatcgacagcctgaaaaacgaacgcgaa
cggatgttcgccgaattgggcaaaatatgccgtctgaacacctttccaagtcaggcaaac
ttcattaccatacgcgtacccgatgccgatttgttgtttgacacgctcaaacaaaaccgc
atcttggttaaaaaactgcatggcgcgcacccgcttttggaacactgcctgcgcattacc
gtaggcagccccgcacaaaacgatgccgttctcaacatcattcgccaactttactgccaa
ccaacggatttcctatga

DBGET integrated database retrieval system