KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1115Help
Entry
NMBM04240196_1115 CDS       T01948                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00260  Glycine, serine and threonine metabolism
nmq00750  Vitamin B6 metabolism
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01120  Microbial metabolism in diverse environments
nmq01230  Biosynthesis of amino acids
Module
nmq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM04240196_1115 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMBM04240196_1115 (thrC)
Enzymes [BR:nmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMBM04240196_1115 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADZ01581
Position
1227239..1228648
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGLAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
NATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPAEINTLWAEVAAGKGFDLRFALDKVGG
KYGFTSGKSTHADRLATIKQVYEQDQELIDPHTADGVKVAREVREEGEMVVCLETALAAK
FDATIREAVGDAAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcccccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggtttagcttatcccgaattggcgtttgaaattatgcgc
ctgtttgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcaatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcg
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaagggcgtgaac
gtatttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcaaatgtacagc
ctgcaagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggat
attgtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aactcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aacgccacttcaagcaatgacgaaaccgtcagcttctgtgtaccgagcggcaacttcggc
aatgtttgcgcgggacacattgccaaacaaatgggcctgcctatccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgc
aacagcgcgcatacttatgtaacctccagcccgtctatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctgcggaaatcaatacgctgtgg
gcggaagtggctgcaggcaaaggctttgacctgcgatttgccttggacaaagtcggtggc
aaatacggttttacctctggcaaatccacccacgccgaccgcctcgccaccatcaagcag
gtttacgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggtgaaatggtggtttgtttggaaaccgcgttggcggcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccctgccgcgctg
gaaggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system