KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1203Help
Entry
NMBM04240196_1203 CDS       T01948                                 

Gene name
sucC
Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmq01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmq00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nmq00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:nmq00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1317372..1318538)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVQGVLINIFGGIVRCDMIAEAIVAAVKEINVNVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacacgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaaccgatgccaacggccaacctgtcaacagcgttttggtttgcgaa
gatatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggcggtgtggaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggtgcgtacaaagcgtttgtcgaaaatgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccgaaaatcgccgaattgcgcgacaaatctcaagaaaac
gaacgcgagttgaaagcttctgaatttgacctgaactatgttgccctggaaggcaacatc
ggctgtatggtgaacggtgccggtttggcgatggccactatggacatcatcaaactgaaa
ggcggccaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattctggaagacaaatccgttcaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcaacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system