KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1212Help
Entry
NMBM04240196_1212 CDS       T01948                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00020  Citrate cycle (TCA cycle)
nmq00190  Oxidative phosphorylation
nmq00650  Butanoate metabolism
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01120  Microbial metabolism in diverse environments
nmq01130  Biosynthesis of antibiotics
nmq01200  Carbon metabolism
Module
nmq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM04240196_1212 (sdhD)
   00650 Butanoate metabolism
    NMBM04240196_1212 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBM04240196_1212 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ADZ01673
Position
complement(1329400..1329741)
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system