KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1374Help
Entry
NMBM04240196_1374 CDS       T01948                                 

Gene name
pgm
Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM04240196_1374 (pgm)
   00030 Pentose phosphate pathway
    NMBM04240196_1374 (pgm)
   00051 Fructose and mannose metabolism
    NMBM04240196_1374 (pgm)
   00052 Galactose metabolism
    NMBM04240196_1374 (pgm)
   00500 Starch and sucrose metabolism
    NMBM04240196_1374 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM04240196_1374 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMBM04240196_1374 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM04240196_1374 (pgm)
Enzymes [BR:nmq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMBM04240196_1374 (pgm)
    5.4.2.8  phosphomannomutase
     NMBM04240196_1374 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1473718..1475100
Genome map
AA seq 460 aa AA seqDB search
MANIARDIFKAYDIRGIVGKTLTDDAAYLIGRAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIIEKDGFVAADKQGNVTEKDISGEYHNHIVGHIKLKRPMKIAIDAGNGV
GGAFAGKLYKGLGNEVTELFCDVDGTFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPKAKVIFDVKSTRLLAPWIKEHGGEPVM
EKTGHSFIKSSMKKTGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgcccgcgacatcttcaaagcctacgacatccgaggcattgtcggcaaa
accctgaccgacgatgccgcctatctcatcggcagggccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgctatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagccattattgaaaaagacggttttgttgcc
gccgacaaacaaggcaacgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggccacatcaaactcaaacgccccatgaaaatcgccatcgacgcaggcaacggcgta
ggcggcgcattcgcaggcaaactctacaaaggcttgggcaatgaagttaccgaacttttc
tgcgacgtggacggcactttccccaaccaccatcccgacccatccaaaccgaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtagttaccaaagacggcaacatcatctatccagaccgccaa
ctgatgcttttcgcgcaagacgtgttgagccgcaatcctaaagccaaagtaattttcgac
gtcaaatccacccgtctgcttgcgccttggattaaagaacacggcggcgaacctgtgatg
gaaaaaaccggccacagctttatcaaatcctccatgaaaaaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system