KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1416Help
Entry
NMBM04240196_1416 CDS       T01948                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1515175..1515669
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDTRLTLPHPR
AHERSFVIRPLAEILPDFVLGKHGKVAELSKRLGNQGIRLLPDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcctgactttgtcaatgcc
gtctgcaccgtttccaccaccttggacggcattgccctgcttgccgaactcaaccgtatc
gaggctgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacacccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatccgccctttggcagaaatcctccctgattttgtttta
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggtatccgtctt
ttaccggacaggtaa

DBGET integrated database retrieval system