KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1467Help
Entry
NMBM04240196_1467 CDS       T01948                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00260  Glycine, serine and threonine metabolism
nmq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01130  Biosynthesis of antibiotics
nmq01230  Biosynthesis of amino acids
Module
nmq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM04240196_1467 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM04240196_1467 (trpB)
Enzymes [BR:nmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMBM04240196_1467 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Phage_Treg
Motif
Other DBs
NCBI-ProteinID: ADZ01910
Position
complement(1567673..1568875)
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLFVSETLIPALQELADAYKAAKNDPEFWEAFRHDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacacggcgggctgttc
gtgtccgagaccctgattccggctttgcaagagctggcggatgcctataaggcagcgaaa
aacgatcctgaattttgggaagcgttccgccatgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgaacatctgggcggcgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgcatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggtatgacttgcgacgtgtatatgggc
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggtgcgaac
gtggtcggtgtagaaagcggcagccgcacgctgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggacgacacgttctacatcatcggtaccgccgccggccccgcg
ccgtatcccgaaatggtgcgcgatttccaatgcgtgattggcaacgaagctaaagcgcag
atgcaggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggcgca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacactgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaacgcgccgaaaatgggcaaagaccaagtgattctggtcaac
ctatccggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system