KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1489Help
Entry
NMBM04240196_1489 CDS       T01948                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBM04240196_1489 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM04240196_1489 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM04240196_1489 (trpA)
Enzymes [BR:nmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMBM04240196_1489 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1586674..1587459)
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSWIVKEIEN
NAGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attacggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
aacggtgcggatattttggagttgggtgtgccgttttccgatccgatggcggatgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgacgcggtcattgtcggcagctggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgcggccgtcggtgctttggtcaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system