KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1619Help
Entry
NMBM04240196_1619 CDS       T01948                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMBM04240196_1619
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM04240196_1619
  Lipid metabolism
   00071 Fatty acid degradation
    NMBM04240196_1619
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBM04240196_1619
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBM04240196_1619
   00626 Naphthalene degradation
    NMBM04240196_1619
Enzymes [BR:nmq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBM04240196_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1722367..1723413
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDEKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggc
atggcgacccactgtatcgtgagtgccgattacgcggtcaaagtcccagaaggcttggat
cctgcgcaagcttcgagcattacttgtgccggtgtaaccacttataaagccattaaagtt
tccagtgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgat
gaaaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggtt
gccatcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgcccaaagtccaactgcgtgctttggatgaagcacccgcc
attttccaagaaatgcgcgaaggcaaaatcaccggtcgtatggtgatcgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system