KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_1824Help
Entry
NMBM04240196_1824 CDS       T01948                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
nmq00010  Glycolysis / Gluconeogenesis
nmq00051  Fructose and mannose metabolism
nmq00562  Inositol phosphate metabolism
nmq01100  Metabolic pathways
nmq01110  Biosynthesis of secondary metabolites
nmq01120  Microbial metabolism in diverse environments
nmq01130  Biosynthesis of antibiotics
nmq01200  Carbon metabolism
nmq01230  Biosynthesis of amino acids
Module
nmq_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM04240196_1824 (tpiA)
   00051 Fructose and mannose metabolism
    NMBM04240196_1824 (tpiA)
   00562 Inositol phosphate metabolism
    NMBM04240196_1824 (tpiA)
Enzymes [BR:nmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMBM04240196_1824 (tpiA)
Exosome [BR:nmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMBM04240196_1824 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMBM04240196_1824 (tpiA)
  Exosomal proteins of melanoma cells
   NMBM04240196_1824 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ02250
Position
1973183..1973956
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system