KEGG   Nitrosopumilus maritimus: Nmar_0024Help
Entry
Nmar_0024         CDS       T00626                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Nmar_0024
Enzymes [BR:nmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Nmar_0024
Transfer RNA biogenesis [BR:nmr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Nmar_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(20451..21266)
Genome map
AA seq 271 aa AA seqDB search
MKNLPILDKIPELDIAIKAAQEAGSAILEIYKGKFEEFTKKDDSPITEADLKSNEIIKGI
LSQTKFCILSEEDKDDQSRLSEEVIWIVDPLDGTSDFIDKTGEFTVMIALVKNKKPILGV
IGWPTEKTLFVAQEGKGAFRYSNEEWKKISVTTTKELSECRTVGSRHHLSEKEKAFIKKL
GIEDFTSIGSSLKVGKIASGEAEAYITTTDKMKEWDSAASHCIISEAGGKMTDMLGNNIS
YNNREVHHQNGILVTNGIIHQTIVDEFKKLE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatttaccaattttagataaaattccagaattagacattgcaatcaaagcagcg
caagaagctggaagtgcaattttagagatttacaagggaaaatttgaagaatttacaaaa
aaagatgattccccaataacagaagcagatctaaaaagtaacgagataatcaaagggatt
ttgtctcagacaaaattttgtattttgtctgaggaagacaaagatgatcaaagtagatta
tctgaagaagtaatttggatagttgatccgttagacggtacttccgattttattgacaaa
actggagagtttactgtaatgattgctcttgtaaaaaataaaaaacctattcttggagtt
ataggttggccaactgaaaaaacattatttgtagcgcaagaaggaaaaggtgcgtttaga
tattctaatgaagaatggaaaaaaatctcagttactacaactaaagaactttcagaatgt
agaactgttggttcaagacatcatctatcagaaaaagaaaaagcctttatcaaaaaatta
ggaattgaagattttacaagtattggtagttcattaaaggttggaaaaattgcatcaggt
gaagctgaagcatacatcactactacagataaaatgaaagaatgggattcagctgcatca
cattgcataatttctgaggcaggtggaaagatgacagatatgcttggaaacaacatttca
tataacaacagggaagttcatcatcaaaatggaattctagttacaaatggaattattcat
caaacaatagttgatgaatttaaaaaattagagtag

DBGET integrated database retrieval system