KEGG   Nitrosopumilus maritimus: Nmar_0038Help
Entry
Nmar_0038         CDS       T00626                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
29723..30280
Genome map
AA seq 185 aa AA seqDB search
MDEERVKKLVRELIIEVGEDPTREGLRETPERIANMYQEIFSGYDSDSELAVQFSEDSDV
VVARDIQFYSMCEHHMLPFFGKIHIAYSPNGRVFGISKLVRLVEKYSKRLQIQERLTKNI
ADELYSQGVKGVVVLADAEHLCMKMRGVRNDATLSSSAFRGIYENKEDKESIMTLIRKRA
SDSAY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaacgtgtaaagaaacttgtcagagaattgataatcgaagttggcgaagat
cctacccgtgagggcttgcgtgaaacacctgaaagaatcgcaaacatgtatcaggaaatc
ttttctggatatgactctgattcagaattagctgttcaattctcagaagattctgacgta
gttgtagcacgtgatattcagttttactcaatgtgtgagcaccatatgcttccattcttt
ggtaaaatccacattgcatattctccaaatggcagagtctttggaatctcaaaactagta
agactagttgaaaagtactctaaacgactccagattcaagaacgcctaaccaaaaacatt
gcagatgaactatactctcaaggtgtcaagggagtagttgttttagctgatgcagagcac
ctatgtatgaaaatgcgtggtgtcagaaatgatgcaacactatcatcatcagcatttaga
ggaatttatgaaaataaagaggataaagagagcattatgactctaattcgaaaacgtgct
tcagattctgcatattag

DBGET integrated database retrieval system