KEGG   Nitrosopumilus maritimus: Nmar_0224Help
Entry
Nmar_0224         CDS       T00626                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0224
   00030 Pentose phosphate pathway
    Nmar_0224
   00051 Fructose and mannose metabolism
    Nmar_0224
   00052 Galactose metabolism
    Nmar_0224
   00500 Starch and sucrose metabolism
    Nmar_0224
   00520 Amino sugar and nucleotide sugar metabolism
    Nmar_0224
  Nucleotide metabolism
   00230 Purine metabolism
    Nmar_0224
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmar_0224
Enzymes [BR:nmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nmar_0224
    5.4.2.8  phosphomannomutase
     Nmar_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
198788..200137
Genome map
AA seq 449 aa AA seqDB search
MAKFFGTNGIRGVFGEDFTLEFIHDMTLAIGTYFKKGPILIGYDGRDSSPTICKVVTSAL
NSIGIDCNVAGIVPTPCLEFAVKKLGYSGGIMITASHNPPQYNGIKPAANDGVEISREDE
IVIEDIYLQKNWIKSATNWGITKTEERAIDVYLNGIASQVNSKLIESKHFKVVLDLGNGA
QAVTAPNFCKLVNCETFLVNENIDGAFPGRGSEPTPQNLSELSKTVIQNNADLGIAFDGD
GDRSIFCDNKGNILTGDKSALLLTKHILTNNPNSLVVTCLNSGSNIEVLAEEFDSKVIRT
KVGSVEVSRKMVPTDALIGFEENGGFMFGKHNQVRDGCMTLALMLDLLTASSNSLSDEIS
NLPPSFTTKDKVSCSPENVPKLISTLKDEFPNSDTTDGIKINIDPRNWVMIRPSGTEPIV
RVYAEAQSQEKLDDLMSEYLQKVKTIISR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattttttggcaccaatggaattcgtggtgtctttggtgaagattttacactg
gaatttatccatgatatgactttggcaattggaacttatttcaaaaaaggaccaatattg
ataggatatgatggtagagattctagtcctacaatctgtaaagttgtaacttctgctcta
aactctataggcattgattgtaatgttgcaggaattgttccaacaccttgtcttgaattt
gcagtaaagaaattaggatactctggaggcatcatgattactgcatctcacaacccccca
caatacaatggaatcaaacctgctgcaaatgatggagtggaaatctctcgtgaagatgaa
atagttattgaggatatttaccttcaaaaaaattggatcaaaagtgctacaaattgggga
attactaaaacagaagaacgtgcaattgatgtttatctaaatggaattgcatcgcaagtt
aattctaaactcatagaatcaaaacatttcaaggttgttttagatcttggaaatggtgct
caggcagttacagcacctaatttttgtaaacttgtcaattgtgaaacttttcttgtaaat
gaaaatattgatggcgcatttccaggacgtggttcagaacccacacctcaaaatctttca
gaattatcaaaaactgttattcaaaacaatgctgatttaggaatagcatttgacggtgac
ggcgatcgaagtattttctgtgacaacaaaggaaatattttgactggtgataaatctgca
ctcttgttaacaaaacatatcttaacaaataatccaaattccttagttgttacttgtttg
aattctggttctaatattgaagttttagcagaagaatttgattccaaagtaattcgtaca
aaagttggaagtgttgaagtttcaagaaaaatggtcccaactgatgctctaattggtttt
gaagaaaatggtggctttatgtttggaaaacataaccaggtaagagatggctgtatgact
ttggcattaatgcttgatctactaactgcatcttcaaattcattatctgatgaaatctcc
aatcttccaccatcttttactacaaaagacaaggtttcatgttctccagaaaatgtacca
aaactaatttctacactaaaagatgaattcccaaattctgatactactgatggcatcaaa
atcaacatagatccaagaaattgggttatgatccgacctagtggaacagaaccaattgtt
agagtatatgcagaagctcaaagtcaagaaaaattagacgatttaatgtctgaatatctc
caaaaagttaagacaatcatctccagataa

DBGET integrated database retrieval system