KEGG   Nitrosopumilus maritimus: Nmar_0493Help
Entry
Nmar_0493         CDS       T00626                                 

Definition
(RefSeq) uroporphyrinogen III synthase HEM4
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nmar_0493
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nmar_0493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
443851..444654
Genome map
AA seq 267 aa AA seqDB search
MLDGKTIAITRSSDDASEFISLAEQTNATPIALPTIELVSKGEKIVDEFLDSVETYNPDY
SVFMSSKAVKLLFDTAKESGKLETLQLAIANTIVISVGPKTTIALETQGIKVNHQPEKTF
SSVGVGELFTQLNAVGKKVIVPRSGASTPFLKELLNKIGIDVSEIHLYDVCAFRDTSQWN
GFRELFSQNKVDGVVFTSASSVRGFFEIMTKDYDENSLLDNLAKLSVVSIGPFTSDELKK
FKVKNTVAEVHTVAGAFEAMKNTLTIA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatggaaagactatagcaatcactcgttcatctgatgatgcttctgaatttatc
tctcttgcagaacaaaccaatgcaacaccaatagccttaccgacaattgaacttgttagt
aagggtgagaaaattgttgatgagtttctggattctgtagaaacatacaatcctgattat
tctgtttttatgagttcaaaggctgtgaaactactctttgatactgcaaaagaatcagga
aaactagaaacccttcaattggcaattgcaaataccattgtaatctctgttggtccaaaa
acaaccattgctcttgaaacacaaggcatcaaagttaatcatcaacctgaaaaaacattc
tcttctgtaggtgttggagaattatttacgcaactcaatgcagttgggaaaaaagttata
gtgcctagaagtggtgcatctacaccatttctcaaagaattactaaacaaaattggaata
gatgtatctgaaattcatctctatgacgtatgtgcatttagagatacatctcaatggaat
ggatttagagaattattctcacaaaacaaagttgatggtgtggtgtttacgagtgcatcc
tcagttcgaggattctttgagataatgactaaagattatgatgaaaattctttattagat
aatctagccaaactttctgtagtttccatcggaccattcacttctgatgaattaaagaaa
ttcaaagttaagaataccgttgctgaggttcatactgttgcgggtgcctttgaagcaatg
aaaaatactcttaccattgcataa

DBGET integrated database retrieval system