KEGG   Nitrosopumilus maritimus: Nmar_0523Help
Entry
Nmar_0523         CDS       T00626                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00010  Glycolysis / Gluconeogenesis
nmr00071  Fatty acid degradation
nmr00350  Tyrosine metabolism
nmr00625  Chloroalkane and chloroalkene degradation
nmr00626  Naphthalene degradation
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01120  Microbial metabolism in diverse environments
nmr01130  Biosynthesis of antibiotics
nmr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0523
  Lipid metabolism
   00071 Fatty acid degradation
    Nmar_0523
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmar_0523
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmar_0523
   00626 Naphthalene degradation
    Nmar_0523
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmar_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N TrkA_N Urocanase NAD_binding_2 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: ABX12419
UniProt: A9A206
Position
466837..467889
Genome map
AA seq 350 aa AA seqDB search
MKSAKIPGPNEPLTISETENPKPSGTQVLLKVKSEGVCHSDLHLWEGGYDLGDGQFLKVT
DRGVKYPVTPGHEIVGTIEEIGENVSNVTVGDDVLVFPWMGCGECPACKVGNENLCDAPK
SMGLFQNGGYADYVLVPNSKYLAKLDGVDPDAATSLACSGLTAYTAIKKANQNSPEFIVI
VGAGGLGLMGVQIASEITNAKIICVDLDDAKLATAKEMGAHFTVNSKDSETVQKIMSICN
DKGADSVVDFVNAPPTVKTGLAVLRKRGNLVLVGLFGGSLELSLVTIPLKSITIQGAYTG
NYNDMVELLGLARKGTINPVISKRYSLDEANSALQDLKDRKILGRAVINP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgccaaaatcccaggtccaaatgaacctctaacaatatctgaaactgaaaac
ccaaaaccatctggaacccaggtattacttaaagtaaaatctgaaggtgtctgtcatagt
gatttgcatctgtgggaaggtggatatgaccttggagatggtcaatttttgaaagtaact
gatcgtggtgtaaaataccctgtaacgcctggacatgaaattgttggaactattgaagag
attggagaaaatgtttcaaatgtaactgtaggtgatgatgttctagtttttccttggatg
ggctgtggtgaatgccctgcatgtaaagttggtaatgaaaatctatgtgatgctccaaaa
tcgatggggcttttccaaaatggtggttatgctgattatgttttagttccgaattctaaa
tatttagcaaaacttgatggtgttgatcctgatgctgcaacttcacttgcatgttctgga
ttaactgcatacactgctatcaaaaaagcaaatcaaaattctccagaattcattgtaatt
gtaggagctggtggattgggattgatgggagttcaaattgctagtgagattactaatgca
aaaatcatttgtgttgatttagatgatgcaaaattagcaacggcaaaagaaatgggtgct
cattttactgtaaattctaaagattctgaaactgttcaaaaaataatgtcaatatgtaat
gataagggtgcagatagtgttgttgactttgttaatgctccaccaactgtaaagactggc
ttagcagtgttaagaaaaagaggaaatcttgttctagttggattatttggtggctcacta
gaattgtctctcgttacaattcctctaaaatcaattaccattcaaggtgcatacactgga
aattacaatgacatggttgaactacttggacttgcaagaaaaggaaccataaacccagtt
atttcaaaaagatattctcttgatgaagcaaattctgcattacaggatcttaaagatcgt
aaaatccttggacgtgcagtcatcaatccatga

DBGET integrated database retrieval system