KEGG   Nitrosopumilus maritimus: Nmar_0667Help
Entry
Nmar_0667         CDS       T00626                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Nmar_0667
Enzymes [BR:nmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Nmar_0667
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Nmar_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
608932..609657
Genome map
AA seq 241 aa AA seqDB search
MEIIPIHIEKEIEPSDDLSELIISSNQIQDGDVIVIAQKIISKQERRLVELSTVKPSLLS
EGISSQYQKDPRITELILSESKRIIRMKNGILIVETNDGTICANAGIDESNVKDGFATLL
PLDSDKSAKNIREKIFKHTNKDVAVIISDTFGRPFRLGQTNCAIGISGLSPIIDYEGTQD
TFGKTLRVTAIAIADELSAASELVMGKTLKTPVAIIRDCSFPKGEQGISELIRAEDEDLF
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatcatacctattcatattgaaaaagagattgaaccttcagatgatctttcagaa
ttgatcatctcttcaaatcaaatccaagatggagatgtcatagtaattgctcaaaaaata
atttcaaaacaagagagacgtctagttgaattgtctactgtaaagccttcattgctttct
gaaggaattagttcacaatatcaaaaagatcctcgtattactgaattaattctatctgaa
tcaaaacgaatcattcgtatgaaaaatggaattttaattgttgaaacaaatgatggtaca
atttgtgctaatgctggcattgatgagagtaatgtaaaagatggatttgcaaccctgttg
ccattggattcagacaaatctgccaaaaacatacgtgaaaaaattttcaaacatacaaac
aaagatgttgcagtgataatttctgatacatttggtcgtccatttagattgggacaaaca
aattgcgctataggaatttcaggattgtcacctataattgactatgagggaactcaagat
acatttggaaaaactttacgtgttactgcaattgcaattgctgatgaactctcagcagca
tctgaattagttatgggcaaaacattgaaaacccctgtagcaataattcgagattgttcg
tttccaaaaggtgaacaaggaatcagtgaattaatccgtgcggaagatgaagatcttttt
agataa

DBGET integrated database retrieval system