KEGG   Nitrosopumilus maritimus: Nmar_0831Help
Entry
Nmar_0831         CDS       T00626                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_0831
   01230 Biosynthesis of amino acids
    Nmar_0831
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0831
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Nmar_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
734100..735152
Genome map
AA seq 350 aa AA seqDB search
MKQVFVNGYGSIGSRITAFLKDDPEILVVGVGKYSPDDDVNLAISRGLNVYVPEKKLDDF
KDFKISGSIESALDNSDLVIDAAPGGHGYKNKKNLYEPRNLPAIYQGGESTMGDDAVSDL
LFNSRANYDLAIGKHHVMQGSCNVTGMGRILEPLRDKFGDNLIRFDVTLVRRWADIEQTD
KKLSDTIEMTEKPHHGDDVKLYFGKDAPLYVRAIKVPTRQMHLHIMDIRFKDTAPKPSEI
HELFTNEFGVATLWTAKGTKDVRDYAQNMGFNFTDTNMIHIHANMTTSIGDTVQMMYSDD
QTGIVIPENHMLMQAMLFEKSYADAFAHTESIFHMVEKKQKLQEHFAKKD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagtttttgttaatgggtatggttccattggcagtagaatcactgcttttctc
aaagatgatcctgaaatcttagttgtgggcgtaggaaaatactctccagacgatgatgtc
aatcttgcaatctctagaggcttgaatgtttatgttcctgaaaaaaaattagatgatttc
aaagatttcaaaatatctggttctattgagtctgcattagacaattctgatcttgtaatt
gatgcagctcctggcggtcatggatacaaaaacaagaaaaatttgtatgaaccacgtaac
cttcctgcaatttaccaaggtggtgaatcaacaatgggcgatgatgcagtttctgatttg
ttgtttaactctagagcaaactatgatcttgcaataggaaaacatcatgtcatgcaagga
agttgtaatgtaactggaatgggtagaatccttgaaccattaagggacaaatttggagat
aatttgattagatttgatgttacacttgttagaagatgggcagacattgaacaaactgac
aaaaaactttcagacaccattgaaatgactgaaaaacctcatcatggtgatgatgtaaaa
ttatactttggaaaagatgcaccactttatgtccgtgcaatcaaagttcctacaagacag
atgcacttacacattatggatattagattcaaagatactgcaccaaaaccttctgagatt
catgaactctttacaaatgaatttggtgttgcaacactttggactgcaaagggaacaaaa
gatgttagagattatgcacaaaatatgggctttaattttacagatactaatatgattcac
attcatgcaaacatgactacttccatcggtgatacggtacaaatgatgtattcagatgat
caaacaggaattgttattccagaaaatcacatgttgatgcaagcaatgttgtttgaaaaa
tcatatgctgatgcatttgctcacactgaatcaatcttccacatggttgaaaagaaacaa
aaattgcaagaacactttgcaaagaaggactag

DBGET integrated database retrieval system