KEGG   Nitrosopumilus maritimus: Nmar_0833Help
Entry
Nmar_0833         CDS       T00626                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmar_0833
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmar_0833
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nmar_0833
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nmar_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(736555..737892)
Genome map
AA seq 445 aa AA seqDB search
MQGDAYLKCIDPQCGMEYPIESTNVQCEKGHLLDVKYKHTPSENLKEVFYNRRNSQGNIF
NESGVWRFRELLNFCQIDTENIEECSKYLVSLDGAEGRLSKPYHMAKASELVGISNDNLW
LQPEGYNPSGSFKDNGMATAVTHAKMVGAKKIVCASTGNTSASAGMFAANEGINCDVYIP
AGQIAPGKLSQAYQFGAQILEIDGNFDDALKQSLDDAQNHDGYTVNSVNPFRIEGQKTIP
FRALEYLNWEVPDWIVYPGGALGNTSSCGKALMELYEWGWIKKIPRIAVINSEGASTLSD
LYNGKFEGEELRWNKGNPNTELITRYYDDLDSKGIRPKTKATAIQIGRPANILKGLRALE
FTNGVATTVSDSEMLDGMSVVGLNGFDCEMASGASVVGVKKLTSEGIIQKDDTVVGILTG
RQKDAMLPVDYHNNPQNKFAKPPKN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagacgcatatctcaagtgtattgatccacaatgcggtatggaataccctatt
gagagcacaaatgttcaatgtgaaaaaggacatctgcttgatgtaaaatacaaacatact
ccctcagaaaatcttaaagaagttttttacaatagaagaaactcgcaagggaacatattc
aatgaaagtggagtttggagattcagagaattactaaacttttgtcaaatagatactgaa
aacattgaagagtgttcaaaatatttggtttcacttgatggtgcagaaggaagactctca
aagccttaccatatggcaaaggcttcagaacttgtaggaatttcaaatgataatttatgg
ttacagcctgaaggatacaatccaagtggttctttcaaagataatggcatggcaactgca
gtaactcatgcaaaaatggtaggtgcaaaaaagattgtttgtgcatctactggaaacact
tcagcatctgcaggtatgtttgcagcaaatgaagggataaattgtgatgtatacattccc
gcaggacaaattgctccaggaaaattaagccaagcgtatcagtttggagctcagatttta
gaaattgatggaaattttgatgatgctctaaaacaatcattagatgatgcacagaatcat
gatgggtatactgtaaattctgttaatccatttagaattgaaggacaaaaaaccatacca
tttagagcattagaatatttgaattgggaagttccagattggattgtttatccaggtggt
gcattagggaacacatctagttgtggaaaagcattgatggaactatatgaatggggatgg
attaaaaaaattccaagaattgcagtgataaactctgaaggtgcaagtacattatctgat
ttgtataatggtaaatttgaaggagaggaattaagatggaataaaggaaaccccaatact
gaattaattacaagatattatgatgatttagactcaaaaggaattagaccaaaaaccaaa
gctactgcaattcaaattggtagacctgcaaatattttgaaaggattacgcgcacttgaa
tttacaaacggtgttgcaacaactgtttcagattctgaaatgcttgatggaatgtcagta
gtaggactaaacggttttgattgtgagatggcatcaggtgcatcagtggttggagttaag
aaattgacgagtgagggaataatacaaaaagacgacacagtggttggaattcttacaggc
agacaaaaagatgcaatgcttccagtagattatcacaataatccccaaaacaagtttgca
aaacctccaaaaaattag

DBGET integrated database retrieval system