KEGG   Nitrosopumilus maritimus: Nmar_0866Help
Entry
Nmar_0866         CDS       T00626                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_0866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0866
   00620 Pyruvate metabolism
    Nmar_0866
   00640 Propanoate metabolism
    Nmar_0866
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Nmar_0866
   00680 Methane metabolism
    Nmar_0866
Enzymes [BR:nmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Nmar_0866
Lipid biosynthesis proteins [BR:nmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Nmar_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(759537..761462)
Genome map
AA seq 641 aa AA seqDB search
MSDFEFVPTQNQVEESNIFRFMQKHGLSSLSELSKKSKDELEWFWQEVDKDIGVVWDSPY
SQILDSSNGIAHSKWFVNGKTNIYKSTVEKFVKLTPDKTAYHFVSEDGATSKLTYQELDN
KVSKLANGLKSLRVKKGDVVAIYLPMIQEAILAILASAKIGAVQTVIFSGYSTESLHIRL
QDCNAKVLFVSDGFCRKGKPISQKETVQKAIQDTYVEKTIVVKYKGVDKYENSENIVFYN
ELIESQNPDCPTEIMDSEDPLFILYTSGTTGKPKGVVHVHGGFSVFAGHQAAYLIDLQAQ
DVLFWPADIGWITGLVWNVYGLLIMGASSVIYDGALDFPKSDRVWKILSEYNATIFGISP
TATRLFKKNNEEPLQNFSLDKIKNIPTTGEPLDEDSWWWLFDKVGNKKIPIMNLSGGTEI
GGAMLSVFPGMKLKPSTVGIPVPGMNLDVVDNDGNSVKNKNGYLIIRSPWPGMTRGLLND
NERFIETYWSRFKDIWFHGDYVFVDQDGLWYMRGRTDDVINVSGHRMSTAEIEHMVISHE
KISDAASIAIPDDITGEAIVIFFVADSKDDSNLEGIVSDFISQKIGKVAKPKFVYQLTDL
PKTRTGKIMRRLLKSKLLGKELGDLSSLENPQILDEVPKIG
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgattttgagtttgttccaacacaaaaccaagttgaagagtccaatatctttcgt
tttatgcaaaaacatggactatcatcactatctgaactatcaaaaaaatcaaaagatgaa
ctagaatggttttggcaagaagttgataaagacatcggagtagtttgggactctccatat
tcacaaatacttgattcctcaaatggaattgcgcattctaaatggtttgtaaatggtaaa
acaaacatctacaaatctacagttgaaaaatttgtaaaattaactcctgataaaactgca
tatcactttgtttcagaagatggggcaacatccaaactcacataccaagaattagacaac
aaagtatcaaaacttgcaaatggtctcaaatcacttagggtcaaaaaaggagatgttgtg
gcaatttatcttccgatgattcaagaagcaattttagcaatattggcttcagctaaaatt
ggcgcagttcaaactgtaatcttttcaggatatagtactgaatcactgcatattagatta
caagattgtaatgcgaaagttctttttgtttcagacggtttttgtagaaaaggaaaacca
atctctcaaaaagaaaccgtgcaaaaagcaattcaagacacatatgttgaaaaaacaatt
gtagtaaaatacaaaggggtggacaagtatgaaaactctgaaaatattgtattttataat
gaattgatagaatctcaaaaccctgattgccctactgaaataatggattctgaggatcct
ttattcatcttgtatacttcgggtactactggaaaaccaaagggtgtggtacatgttcat
ggtggtttttccgtatttgcaggacatcaggcagcatatttgatagatttacaggcacaa
gatgtgttattttggcctgcagatattggttggattactggtcttgtctggaatgtctat
ggattgctaatcatgggagcaagttccgtgatttatgacggagcattagattttccaaaa
tctgacagagtatggaaaattctttcagagtataatgcaacaatatttggaatctctcct
actgcaacaagattattcaagaaaaataatgaagaaccattacaaaatttctcattagat
aaaatcaaaaatattccaacaacgggtgaaccacttgatgaggattcatggtggtggttg
tttgataaagttggaaacaagaaaattccaataatgaatttgtctggcggaactgaaatt
ggtggtgcaatgttgtctgtttttccagggatgaaactaaaaccttcaactgttggtatt
ccagttcctggaatgaaccttgatgtagttgataatgatggaaattcagtcaaaaacaaa
aatggctatctcataattagatcaccttggccaggaatgactcgggggttactaaatgac
aatgagcggttcattgaaacttattggtctagattcaaagacatttggtttcatggggat
tatgtctttgttgatcaagatggtctttggtatatgcgtggaagaactgatgatgtgatt
aatgtctctggacaccgaatgagtactgctgaaattgaacatatggtaatttcacatgaa
aaaatttctgatgcagcatctattgcaattcctgatgatattactggcgaggctattgtt
attttctttgttgcagatagtaaagatgattctaatttggaaggtatagtttctgatttt
atttctcaaaagattggcaaagttgcaaaaccaaagtttgtttatcaattgactgatttg
ccaaaaactagaacgggaaaaattatgagacgattactaaaatcaaaattattgggaaaa
gagttaggtgatttgtcttctctagagaatcctcagatactagatgaggttccaaaaatt
ggttaa

DBGET integrated database retrieval system