KEGG   Nitrosopumilus maritimus: Nmar_0870Help
Entry
Nmar_0870         CDS       T00626                                 

Definition
hypothetical protein
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:nmr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(764618..764884)
Genome map
AA seq 88 aa AA seqDB search
MVTEEEIEKVAKLMKIEVDDHKEYVDKVHAMIDYFDILDSAGVEDEEISMQEIPITALRE
DKHIPFDEKLIEKLNHYKGTYVRAPKMS
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggttacagaagaagagattgagaaagtagcaaaattaatgaaaatcgaggtagatgat
cataaagagtatgtagacaaggtacatgctatgatcgattattttgacattttagattct
gcaggagttgaggatgaagaaatctctatgcaagaaattcctattactgctttacgtgaa
gataaacacatcccatttgatgaaaaactcattgaaaaactaaatcactacaaaggaacc
tatgttcgagctccaaagatgtcataa

DBGET integrated database retrieval system