KEGG   Nitrosopumilus maritimus: Nmar_0870Help
Entry
Nmar_0870         CDS       T00626                                 

Definition
hypothetical protein
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nmar_0870
Enzymes [BR:nmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Nmar_0870
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Nmar_0870
Mitochondrial biogenesis [BR:nmr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Nmar_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(764618..764884)
Genome map
AA seq 88 aa AA seqDB search
MVTEEEIEKVAKLMKIEVDDHKEYVDKVHAMIDYFDILDSAGVEDEEISMQEIPITALRE
DKHIPFDEKLIEKLNHYKGTYVRAPKMS
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggttacagaagaagagattgagaaagtagcaaaattaatgaaaatcgaggtagatgat
cataaagagtatgtagacaaggtacatgctatgatcgattattttgacattttagattct
gcaggagttgaggatgaagaaatctctatgcaagaaattcctattactgctttacgtgaa
gataaacacatcccatttgatgaaaaactcattgaaaaactaaatcactacaaaggaacc
tatgttcgagctccaaagatgtcataa

DBGET integrated database retrieval system