KEGG   Nitrosopumilus maritimus: Nmar_0914Help
Entry
Nmar_0914         CDS       T00626                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01130  Biosynthesis of antibiotics
nmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmar_0914
Enzymes [BR:nmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nmar_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE FMN_dh Cellulase His_biosynth AP_endonuc_2 ThiG
Motif
Other DBs
NCBI-ProteinID: ABX12810
UniProt: A9A299
Position
797937..798713
Genome map
AA seq 258 aa AA seqDB search
MAENILRKLVNNSQMAINDGVYEVEGNLEKSNKDFIQIIKTSGHAPLLTEVKFSSPSLGK
IRTITDPVSIASQMIAGGSKALSVLTQPHLFNGSPEYFMKVRQAVDVPMLMKDIMIDKVQ
IDAAKNIGADFMLVIQSLFDQNFLKEIDEFIAYGHKQGLQILLEVHTKQEFENALKTEAD
LIGINNRNLDTLEIDLKTTETILSGIDKSRPILSESGIDTPEDIQYLKKCGADAFLIGSS
IMKSDNIEEQVKKLVNAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatattctaagaaaactagtaaacaattcacagatggcaattaatgatgga
gtatacgaagttgaaggtaatttagaaaaatcaaacaaggactttattcaaattatcaag
actagcggacatgcgccattactcacagaagtgaaattttcatcaccatcgttaggcaag
attcgcacgattacagaccctgtaagcatagcatctcaaatgatagcaggaggctcaaag
gcactatccgtattaacacaaccacatctattcaacggttcaccagagtatttcatgaaa
gtaagacaggcagttgatgttccaatgttaatgaaagatatcatgattgacaaagttcag
attgatgctgcaaaaaatattggagcagactttatgttagtaattcagtcattatttgat
caaaattttctaaaagagattgatgagtttattgcatatggacacaaacaaggacttcag
attctactagaagtacatacaaaacaagaatttgaaaatgcattaaagacagaagctgat
ttgattggaattaacaatagaaatctagacacattagaaattgatctaaaaaccactgag
acaatattatcaggaattgacaaatcaagaccaatactatctgaaagtggcatagacaca
cctgaagacattcaatatctaaaaaagtgtggagcagatgcatttctgataggatcaagt
ataatgaaaagtgacaacattgaagaacaagtaaagaaattggtgaatgcgtattga

DBGET integrated database retrieval system