KEGG   Nitrosopumilus maritimus: Nmar_0914Help
Entry
Nmar_0914         CDS       T00626                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmar_0914
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmar_0914
Enzymes [BR:nmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Nmar_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
797937..798713
Genome map
AA seq 258 aa AA seqDB search
MAENILRKLVNNSQMAINDGVYEVEGNLEKSNKDFIQIIKTSGHAPLLTEVKFSSPSLGK
IRTITDPVSIASQMIAGGSKALSVLTQPHLFNGSPEYFMKVRQAVDVPMLMKDIMIDKVQ
IDAAKNIGADFMLVIQSLFDQNFLKEIDEFIAYGHKQGLQILLEVHTKQEFENALKTEAD
LIGINNRNLDTLEIDLKTTETILSGIDKSRPILSESGIDTPEDIQYLKKCGADAFLIGSS
IMKSDNIEEQVKKLVNAY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatattctaagaaaactagtaaacaattcacagatggcaattaatgatgga
gtatacgaagttgaaggtaatttagaaaaatcaaacaaggactttattcaaattatcaag
actagcggacatgcgccattactcacagaagtgaaattttcatcaccatcgttaggcaag
attcgcacgattacagaccctgtaagcatagcatctcaaatgatagcaggaggctcaaag
gcactatccgtattaacacaaccacatctattcaacggttcaccagagtatttcatgaaa
gtaagacaggcagttgatgttccaatgttaatgaaagatatcatgattgacaaagttcag
attgatgctgcaaaaaatattggagcagactttatgttagtaattcagtcattatttgat
caaaattttctaaaagagattgatgagtttattgcatatggacacaaacaaggacttcag
attctactagaagtacatacaaaacaagaatttgaaaatgcattaaagacagaagctgat
ttgattggaattaacaatagaaatctagacacattagaaattgatctaaaaaccactgag
acaatattatcaggaattgacaaatcaagaccaatactatctgaaagtggcatagacaca
cctgaagacattcaatatctaaaaaagtgtggagcagatgcatttctgataggatcaagt
ataatgaaaagtgacaacattgaagaacaagtaaagaaattggtgaatgcgtattga

DBGET integrated database retrieval system