KEGG   Nitrosopumilus maritimus: Nmar_0915Help
Entry
Nmar_0915         CDS       T00626                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmar_0915
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmar_0915
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmar_0915
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nmar_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
798710..799897
Genome map
AA seq 395 aa AA seqDB search
MKYPKNGRFGEFGGKYIPETLVPAIEELEENYLKFKNDKNFKKELDYYLKVYAGRPTPLY
YAKNLSEKLGGAKIYLKREDLLHGGAHKINNTLGQALLAKKMKKKRIIAETGAGQHGVAT
AMACATLGMKAEVYMGYKDTIRQKLNVFRMNLLGSKVHPVKSGSKTLKDAINEAIRDWIT
NVETTYYLLGSAVGPHPYPVMVRDFQSVIGNEIKSQMKKLNKTPDSVIACVGGGSNAIGT
FYPLVDSNAEIIGVEAAGHGLKSKKHSATLSAGSKGVLHGMMTYLLQDKEGQITETHSIS
AGLDYPGVGPEHSYFKDTKRVKYHAATDTEVIDAFLMLTRTEGIIPALESAHAIAEAIKV
ARKSKKSESIVVTLSGRGDKDVEEVQNYLSKNVKD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatcctaaaaatggcagatttggagaatttggtggaaagtacattccagaaacc
ctagttcctgcaatagaagaattggaagaaaactatcttaaatttaaaaatgacaaaaat
ttcaaaaaagaactagattattatctcaaggtttacgcaggtcgtccaaccccactatat
tatgcaaaaaacttatcagagaaactaggtggtgcaaaaatttatctcaaaagagaagac
ttgttgcatggaggagctcacaagataaacaatacacttggacaagcactacttgcaaaa
aagatgaaaaagaaaagaatcattgctgaaactggtgcaggtcagcatggagttgcaact
gccatggcatgtgcaacattaggaatgaaagccgaagtatacatgggctacaaagacact
atcaggcagaaactaaacgtatttcgaatgaatttactgggctcaaaagttcacccagta
aaatcaggttctaaaacactcaaggatgcaatcaatgaagcaatcagagattggattaca
aatgtagagactacttactatctacttggttcagcagtaggaccccacccataccctgta
atggtcagagactttcaaagtgttattggaaatgaaataaaatcacagatgaaaaaacta
aacaaaacacctgacagtgtaattgcatgtgtaggtggaggttccaatgcaatcggcaca
ttttatccactagtggattctaatgcagagattattggagtagaagctgcaggtcatgga
ttaaaatcaaaaaaacattcagcaacattatcagctggaagtaaaggagttcttcatggc
atgatgacatatctgcttcaagataaagaaggacaaattacagagacacatagcatctca
gctggacttgattacccaggtgttggaccagagcactcttactttaaagacactaaacga
gtaaaatatcatgcagcaacagatacagaagtaattgacgcatttctcatgttaactaga
acagaaggaatcattccagctttagaatcagctcatgcaattgcagaagcaatcaaagtt
gcaagaaagagtaaaaaatctgaatcaattgtagtaacactttctggaagaggagacaaa
gacgtagaagaagttcaaaattatctgagtaaaaatgtcaaagattaa

DBGET integrated database retrieval system