KEGG   Nitrosopumilus maritimus: Nmar_0916Help
Entry
Nmar_0916         CDS       T00626                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmar_0916
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmar_0916
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmar_0916
Enzymes [BR:nmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nmar_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
799884..800690
Genome map
AA seq 268 aa AA seqDB search
MSKIKEKFAELQTRKEKALISYIMAGFPNEKSTMSVVRGLVKGGVDIIELGFPFSDPLAD
GPVIQNASTISLEKGTKIDKFFALVKKIRKETDIPLVLMTYTNILYHKGYSKFIAEAKKS
GIDGFILPDMSIEESKDYLKAARKNADTIFLISPNTNKTRIQKIAKASSGFLYLVAVYGT
TGVKTGIKNYTIDAIKNVKKQTKGKIPVGVGFGVSTPDDVKKYIKAGADGVIVGSAFLKL
IEKTPQNKLESKIASFTKSLKKQTLQKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagattaaagaaaagtttgcagaattgcaaacaagaaaagaaaaggccctaatt
tcatatattatggcaggttttccaaatgaaaaatcaacaatgtcagttgttagaggatta
gtaaagggaggagtagatattatcgagttgggatttccattctctgatcctcttgcagat
gggccagttattcaaaatgcaagcacgatatcccttgagaaaggcacaaaaatagacaaa
ttttttgcgctagtaaaaaaaatcagaaaggagacagatattcctctagtactcatgaca
tacaccaatatcctataccacaaaggatattcaaaattcatagcagaggcaaaaaaatca
ggaattgatggatttattctaccagatatgtccatagaagaatcaaaagattatcttaaa
gctgcaagaaaaaatgcagacacaatatttctaatatcccccaataccaataaaacaaga
attcaaaagattgccaaagcatcttcaggatttttgtaccttgttgcagtttatggaact
acaggagtaaaaacaggaattaaaaattacactatagatgctatcaaaaatgtcaaaaag
caaacaaaaggaaaaattccagttggtgtagggtttggagtttcaacacctgatgatgta
aaaaaatacatcaaagcaggagcagatggagtaattgtaggtagtgcttttttgaaatta
attgagaaaactcctcaaaacaaactagagtcaaaaatagcatcatttacaaaatcacta
aaaaaacagacattgcagaaaaaataa

DBGET integrated database retrieval system