KEGG   Nitrosopumilus maritimus: Nmar_0925Help
Entry
Nmar_0925         CDS       T00626                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nmr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(809190..810065)
Genome map
AA seq 291 aa AA seqDB search
MSFLDLYMNKNPMITASDDDSEPVATVFGIPFDATHSYKPGCRFGPDAIRDSFNNIEIFH
PELSIDLETVHIEDLGNTRHTVVASEMIDMVKKITTELVAKQRQLFILGGEHSITYGTYT
SFPKDTGYVVFDAHYDLRDEFADIKLSHASYLRRVVEERGAENILHVGARAFVKEELEFL
TEHKIKTISDKEIRDGKGPQLLKDHVSTFDTMYSSFDLDVLDPAFAPGVGNPEAVGITSR
ELFDMIYSLQETKVIGADIVELNPYHDNGATASLAAKIMSTLIAINLSQNQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagctttcttgatttatacatgaacaaaaatcccatgattactgcctcagacgatgat
tctgaacctgtagcaaccgtttttggaattccttttgatgcaacccattcatacaaacct
ggttgtagatttggtcctgatgcaattagagattcttttaacaatattgagatatttcat
cctgaactctctatagatttagaaactgtacacattgaggatttgggtaatactcgtcac
acagttgtagcatctgagatgattgacatggtaaaaaaaattacaactgaacttgttgca
aaacaaagacagttgttcattttgggaggtgaacactctatcacatatggaacgtacact
agttttccaaaagatactggttatgttgtatttgacgcccactatgacttgagagatgaa
tttgcagatatcaaactcagtcatgcatcttatcttagacgcgttgttgaagaacgaggt
gcagaaaacattctacatgttggagctcgtgcatttgttaaagaagaattggaatttcta
actgaacataaaatcaaaaccatttctgacaaagaaattcgtgacggaaaaggcccccag
ttactaaaagatcatgtttcaacttttgatacaatgtattctagttttgatcttgatgtt
cttgatcctgcatttgcacctggtgttggaaatcctgaagctgtaggaataacttctaga
gaattatttgatatgatttactctcttcaagaaaccaaagttattggtgctgatatagtt
gaactaaacccttaccatgataatggtgccactgcatctcttgcagcaaagataatgtcc
acgcttattgcaattaatctatctcaaaatcaataa

DBGET integrated database retrieval system