KEGG   Nitrosopumilus maritimus: Nmar_0935Help
Entry
Nmar_0935         CDS       T00626                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nmr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
815847..816866
Genome map
AA seq 339 aa AA seqDB search
MQKLVWPNDINVRHIYFNFKRFYFALDNTSKDLYEALQESCNSCKSNLISLSGGLDSSII
AYFLKERKPNTLAIIAEDFVSTDLTYCQLVSKEMDLPLTIFNVKTAEILEAVEQTIKILK
NFNDIEIRNNVVMYLAIKWAKDNGEKSIITGDGADELFAGYNFLVHKSEEELESEINRVC
SIMHFPTQGIGKALGIKIESPFLSDKVISLAKKIPANLKVKEENKKRHGKWILRKTFEPY
IPEQITWREKSPMQEGSGTSGLTNLFESIIEEEKYVEKKLTVEKEDNVVIRSRESMHYYE
IFKKLYGSPVDKEAKSVCPYCKHKVENSKFCRMCGAFPI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaattagtctggccaaatgatatcaatgtcaggcatatctattttaatttcaaa
agattctattttgcattggataacacctcaaaggatctttatgaggcattacaagaatca
tgtaattcttgcaagtcaaatttaatttctttatcaggagggctagatagttcaattatc
gcatattttctcaaagaaagaaaaccaaacacattagcaataattgcagaagattttgtt
tcaacagatctaacatactgccaactagtttcaaaagaaatggatttaccattaacaatt
ttcaatgtaaaaactgcagaaattcttgaagcagttgaacaaacaataaaaattctaaaa
aactttaacgatattgaaattagaaataatgttgtcatgtatcttgccataaaatgggca
aaagataatggagaaaaatcgatcattacaggagatggcgcagatgaactatttgcagga
tataatttcctagttcataaatcagaagaagagttagaatctgagatcaatagagtctgc
tcaattatgcattttccaacacaagggattggcaaagcattaggaattaagatagaatca
ccattcttgagtgataaagtgatcagtctggcaaaaaaaatacctgcaaatttgaaggta
aaagaagagaacaagaagagacatggaaaatggattttacgtaaaacattcgagccttac
attccagaacaaatcacatggagggaaaaatcaccaatgcaagaaggttcaggaacatca
gggttgacaaacctgtttgaatcaatcattgaagaagaaaagtatgttgaaaagaaatta
actgttgaaaaagaagacaatgtagtcatcagaagtagagaatcaatgcactattatgag
atttttaagaaattatacggttctcctgtagacaaagaagcaaaatctgtgtgtccgtac
tgcaaacataaagttgagaattcaaaattttgcagaatgtgcggtgcttttcctatttga

DBGET integrated database retrieval system