KEGG   Nitrosopumilus maritimus: Nmar_0935Help
Entry
Nmar_0935         CDS       T00626                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00250  Alanine, aspartate and glutamate metabolism
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nmar_0935
Enzymes [BR:nmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nmar_0935
Peptidases [BR:nmr01002]
 Cysteine Peptidases
  Family C44
   Nmar_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase QueC NAD_synthase DZR zinc_ribbon_2 tRNA_Me_trans zinc_ribbon_15 Cript UPF0547 ATP_bind_3 zf-ribbon_3 zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: ABX12831
UniProt: A9A2C0
Position
815847..816866
Genome map
AA seq 339 aa AA seqDB search
MQKLVWPNDINVRHIYFNFKRFYFALDNTSKDLYEALQESCNSCKSNLISLSGGLDSSII
AYFLKERKPNTLAIIAEDFVSTDLTYCQLVSKEMDLPLTIFNVKTAEILEAVEQTIKILK
NFNDIEIRNNVVMYLAIKWAKDNGEKSIITGDGADELFAGYNFLVHKSEEELESEINRVC
SIMHFPTQGIGKALGIKIESPFLSDKVISLAKKIPANLKVKEENKKRHGKWILRKTFEPY
IPEQITWREKSPMQEGSGTSGLTNLFESIIEEEKYVEKKLTVEKEDNVVIRSRESMHYYE
IFKKLYGSPVDKEAKSVCPYCKHKVENSKFCRMCGAFPI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgcagaaattagtctggccaaatgatatcaatgtcaggcatatctattttaatttcaaa
agattctattttgcattggataacacctcaaaggatctttatgaggcattacaagaatca
tgtaattcttgcaagtcaaatttaatttctttatcaggagggctagatagttcaattatc
gcatattttctcaaagaaagaaaaccaaacacattagcaataattgcagaagattttgtt
tcaacagatctaacatactgccaactagtttcaaaagaaatggatttaccattaacaatt
ttcaatgtaaaaactgcagaaattcttgaagcagttgaacaaacaataaaaattctaaaa
aactttaacgatattgaaattagaaataatgttgtcatgtatcttgccataaaatgggca
aaagataatggagaaaaatcgatcattacaggagatggcgcagatgaactatttgcagga
tataatttcctagttcataaatcagaagaagagttagaatctgagatcaatagagtctgc
tcaattatgcattttccaacacaagggattggcaaagcattaggaattaagatagaatca
ccattcttgagtgataaagtgatcagtctggcaaaaaaaatacctgcaaatttgaaggta
aaagaagagaacaagaagagacatggaaaatggattttacgtaaaacattcgagccttac
attccagaacaaatcacatggagggaaaaatcaccaatgcaagaaggttcaggaacatca
gggttgacaaacctgtttgaatcaatcattgaagaagaaaagtatgttgaaaagaaatta
actgttgaaaaagaagacaatgtagtcatcagaagtagagaatcaatgcactattatgag
atttttaagaaattatacggttctcctgtagacaaagaagcaaaatctgtgtgtccgtac
tgcaaacataaagttgagaattcaaaattttgcagaatgtgcggtgcttttcctatttga

DBGET integrated database retrieval system