KEGG   Nitrosopumilus maritimus: Nmar_0950Help
Entry
Nmar_0950         CDS       T00626                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_0950
   01230 Biosynthesis of amino acids
    Nmar_0950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0950
   00051 Fructose and mannose metabolism
    Nmar_0950
   00562 Inositol phosphate metabolism
    Nmar_0950
Enzymes [BR:nmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmar_0950
Exosome [BR:nmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmar_0950
  Exosomal proteins of bladder cancer cells
   Nmar_0950
  Exosomal proteins of melanoma cells
   Nmar_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827535..828191
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEISGEKITKFVKTAEKVSKKFKVKIAICPPQHLIGVVANSSIPIFAQHID
DSKVGSTTGFVIPELLKKSQVNGSLINHSEHRISSKEITKLVSKLKELKMTSIVCVKDVA
EARKYAKLNPNYIAIEPPELIGSGKAVSTERPELITKAANAVKSANNNTKLLCGAGIVSG
QDVSKAVELGSKGILVASGIIKAKNWDKIISEFAKALV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttattaattgtaaaaactatgaagagatttcaggtgaaaagattactaaattt
gtaaagactgctgaaaaagtatcaaaaaaattcaaagtaaaaattgcaatttgcccacct
cagcatttgattggcgttgttgcaaacagttcaattccaatttttgcacaacacattgat
gattccaaagtaggtagcacaactggatttgtaattccagaattgttaaaaaaatcccaa
gtaaatggatcactaatcaatcatagcgaacatagaatttcatcaaaagagatcacaaaa
ctagtatcaaaactaaaagaattgaagatgacatcaattgtttgtgtaaaagatgttgct
gaagcaagaaaatatgcaaaactaaacccaaattatattgcaatagagccaccagagctt
attggatcagggaaagcagtgtcaactgaaagaccagaattaattacaaaagcagcaaat
gctgtaaaaagtgcaaataacaatacaaaacttctttgtggtgcaggaattgtttctgga
caagatgtttcaaaggcagtagaattaggatcaaaagggatccttgtggcaagcggcatt
atcaaagcaaagaattgggacaaaataatttctgaatttgccaaggcattagtttaa

DBGET integrated database retrieval system