KEGG   Nitrosopumilus maritimus: Nmar_0950Help
Entry
Nmar_0950         CDS       T00626                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_0950
   01230 Biosynthesis of amino acids
    Nmar_0950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_0950
   00051 Fructose and mannose metabolism
    Nmar_0950
   00562 Inositol phosphate metabolism
    Nmar_0950
Enzymes [BR:nmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmar_0950
Exosome [BR:nmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmar_0950
  Exosomal proteins of bladder cancer cells
   Nmar_0950
  Exosomal proteins of melanoma cells
   Nmar_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
827535..828191
Genome map
AA seq 218 aa AA seqDB search
MFVINCKNYEEISGEKITKFVKTAEKVSKKFKVKIAICPPQHLIGVVANSSIPIFAQHID
DSKVGSTTGFVIPELLKKSQVNGSLINHSEHRISSKEITKLVSKLKELKMTSIVCVKDVA
EARKYAKLNPNYIAIEPPELIGSGKAVSTERPELITKAANAVKSANNNTKLLCGAGIVSG
QDVSKAVELGSKGILVASGIIKAKNWDKIISEFAKALV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttattaattgtaaaaactatgaagagatttcaggtgaaaagattactaaattt
gtaaagactgctgaaaaagtatcaaaaaaattcaaagtaaaaattgcaatttgcccacct
cagcatttgattggcgttgttgcaaacagttcaattccaatttttgcacaacacattgat
gattccaaagtaggtagcacaactggatttgtaattccagaattgttaaaaaaatcccaa
gtaaatggatcactaatcaatcatagcgaacatagaatttcatcaaaagagatcacaaaa
ctagtatcaaaactaaaagaattgaagatgacatcaattgtttgtgtaaaagatgttgct
gaagcaagaaaatatgcaaaactaaacccaaattatattgcaatagagccaccagagctt
attggatcagggaaagcagtgtcaactgaaagaccagaattaattacaaaagcagcaaat
gctgtaaaaagtgcaaataacaatacaaaacttctttgtggtgcaggaattgtttctgga
caagatgtttcaaaggcagtagaattaggatcaaaagggatccttgtggcaagcggcatt
atcaaagcaaagaattgggacaaaataatttctgaatttgccaaggcattagtttaa

DBGET integrated database retrieval system