KEGG   Nitrosopumilus maritimus: Nmar_1035Help
Entry
Nmar_1035         CDS       T00626                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_1035
   01230 Biosynthesis of amino acids
    Nmar_1035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_1035
   00030 Pentose phosphate pathway
    Nmar_1035
   00051 Fructose and mannose metabolism
    Nmar_1035
  Energy metabolism
   00680 Methane metabolism
    Nmar_1035
Enzymes [BR:nmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Nmar_1035
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Nmar_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
909195..910340
Genome map
AA seq 381 aa AA seqDB search
MENMKITVSVIKADVGGVGGHTKPSDGLLDAIRNTVKNSADLLIDYYIGYCGDDTHIVMS
HTHGVDNQQIHKLAWDAFMAGTQVAKEEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEE
RPNEAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKNLADGVKINIMDVEKAQIAE
LQLWEDKPTIEAALMYPGRYVVDSVTTKDGEPILAASTDRLHNIAGTYVGKDDPICVVRT
QKKFPATEEVGSVFNNPHFVAGNTRGSHNMPLMPVKLNSAATINFCIPIVEALVFSMHNG
KFTGPFDGFSTPDWDLIRERATEKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLESK
MKPMEGTDSSGDRKENYEDPD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgaaaattacagtttcagttatcaaagccgatgtcggcggtgtcggagga
catacaaaacctagtgacggattattagacgcaattagaaataccgttaaaaattcagca
gatttgcttatcgattattacattggatattgtggtgatgacacccatatcgtaatgtct
cacactcatggtgtagacaatcaacaaattcacaaactagcatgggatgcattcatggca
ggaactcaagttgcaaaagaagagggattgtatggtgcaggacaagacttgctcaaagac
tctttctctggaaacgtaaaaggaatgggtccaggagttgcagaaatggaatttgaagaa
agaccaaatgaagcatttacagtatttgcagctgacaaaacagaaccaggtgcattcaac
tatccaatttacagaatgtttgtagatgcactaagtaacacaggattaattgtaaacaag
aatcttgcagacggggttaaaattaatatcatggatgttgaaaaggctcagattgcagag
ttgcaattatgggaagataaaccaacaattgaagcagcattaatgtatccaggtagatac
gttgtagattcagttacaacaaaagatggagaaccaattcttgccgcatcaactgataga
ttacacaatattgcaggaacatatgttggaaaagacgatccaatttgtgttgtcagaaca
caaaagaaattccctgcaactgaagaagtaggaagtgtgtttaacaatccacattttgtt
gcaggaaacacaagaggaagtcataatatgccattaatgcctgtaaaactaaactctgca
gctacaatcaacttttgtattccaatcgttgaggcacttgtatttagtatgcataacgga
aagtttacaggaccatttgatggattctcaactccagattgggatctaatcagagagaga
gcaacagagaaagccatggcaattagaagccaaggatttatccatccagcaacacttgta
ccatcagaactagaatatgctgaaggttatagagctagaatggatgttcttgaaagtaag
atgaaaccaatggaaggaactgattctagcggtgacagaaaagagaattacgaagatcca
gattag

DBGET integrated database retrieval system