KEGG   Nitrosopumilus maritimus: Nmar_1035Help
Entry
Nmar_1035         CDS       T00626                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00010  Glycolysis / Gluconeogenesis
nmr00030  Pentose phosphate pathway
nmr00051  Fructose and mannose metabolism
nmr00680  Methane metabolism
nmr01100  Metabolic pathways
nmr01110  Biosynthesis of secondary metabolites
nmr01120  Microbial metabolism in diverse environments
nmr01130  Biosynthesis of antibiotics
nmr01200  Carbon metabolism
nmr01230  Biosynthesis of amino acids
Module
nmr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_1035
   00030 Pentose phosphate pathway
    Nmar_1035
   00051 Fructose and mannose metabolism
    Nmar_1035
  Energy metabolism
   00680 Methane metabolism
    Nmar_1035
Enzymes [BR:nmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Nmar_1035
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Nmar_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ABX12931
UniProt: A9A3J9
Position
909195..910340
Genome map
AA seq 381 aa AA seqDB search
MENMKITVSVIKADVGGVGGHTKPSDGLLDAIRNTVKNSADLLIDYYIGYCGDDTHIVMS
HTHGVDNQQIHKLAWDAFMAGTQVAKEEGLYGAGQDLLKDSFSGNVKGMGPGVAEMEFEE
RPNEAFTVFAADKTEPGAFNYPIYRMFVDALSNTGLIVNKNLADGVKINIMDVEKAQIAE
LQLWEDKPTIEAALMYPGRYVVDSVTTKDGEPILAASTDRLHNIAGTYVGKDDPICVVRT
QKKFPATEEVGSVFNNPHFVAGNTRGSHNMPLMPVKLNSAATINFCIPIVEALVFSMHNG
KFTGPFDGFSTPDWDLIRERATEKAMAIRSQGFIHPATLVPSELEYAEGYRARMDVLESK
MKPMEGTDSSGDRKENYEDPD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgaaaattacagtttcagttatcaaagccgatgtcggcggtgtcggagga
catacaaaacctagtgacggattattagacgcaattagaaataccgttaaaaattcagca
gatttgcttatcgattattacattggatattgtggtgatgacacccatatcgtaatgtct
cacactcatggtgtagacaatcaacaaattcacaaactagcatgggatgcattcatggca
ggaactcaagttgcaaaagaagagggattgtatggtgcaggacaagacttgctcaaagac
tctttctctggaaacgtaaaaggaatgggtccaggagttgcagaaatggaatttgaagaa
agaccaaatgaagcatttacagtatttgcagctgacaaaacagaaccaggtgcattcaac
tatccaatttacagaatgtttgtagatgcactaagtaacacaggattaattgtaaacaag
aatcttgcagacggggttaaaattaatatcatggatgttgaaaaggctcagattgcagag
ttgcaattatgggaagataaaccaacaattgaagcagcattaatgtatccaggtagatac
gttgtagattcagttacaacaaaagatggagaaccaattcttgccgcatcaactgataga
ttacacaatattgcaggaacatatgttggaaaagacgatccaatttgtgttgtcagaaca
caaaagaaattccctgcaactgaagaagtaggaagtgtgtttaacaatccacattttgtt
gcaggaaacacaagaggaagtcataatatgccattaatgcctgtaaaactaaactctgca
gctacaatcaacttttgtattccaatcgttgaggcacttgtatttagtatgcataacgga
aagtttacaggaccatttgatggattctcaactccagattgggatctaatcagagagaga
gcaacagagaaagccatggcaattagaagccaaggatttatccatccagcaacacttgta
ccatcagaactagaatatgctgaaggttatagagctagaatggatgttcttgaaagtaag
atgaaaccaatggaaggaactgattctagcggtgacagaaaagagaattacgaagatcca
gattag

DBGET integrated database retrieval system