KEGG   Nitrosopumilus maritimus: Nmar_1123Help
Entry
Nmar_1123         CDS       T00626                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmar_1123
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmar_1123
   00640 Propanoate metabolism
    Nmar_1123
   00660 C5-Branched dibasic acid metabolism
    Nmar_1123
Enzymes [BR:nmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nmar_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1026949..1028055
Genome map
AA seq 368 aa AA seqDB search
MQLLEFQAKELFREYGINLLDSISSTNIEEGRKHAKELGYPFVIKIQVPVGGRGKAGGIQ
KCQNDDEFEIKYPQVMDLTIKGEKARAILLEKMADIKKELYLSIFLNRSKRCYTIIASDE
GGVEIESVKNQIIKEIGLGEVSDDLAQEVAKEMGLEGKHAEGVVDTLKKLSKLTIEKEAE
LVEINPLAIMQDDSITALDGKFVTDDNSNFRHPELEKYQEKSEIEEQAEKSGFSLVELDG
DIAVVGNGAGLVMSTLDMLSDNGGKPACFLDVGGGATTESVYEALTLISKLDRVKGILVN
LYGGIVKTTVVAEAFLKAYEDNVIDLPVFSRLKGTESEKATEMLQGSRTKIFSTVEEAIN
AAVMGVKN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcaattactagaatttcaggcaaaagagctatttcgtgaatatggcatcaacctgcta
gacagtatttcatctacaaatatcgaagagggtagaaagcatgcaaaagagttaggatat
ccatttgtgattaaaattcaggttccagtaggaggcagaggtaaggctggaggtatccaa
aaatgccaaaatgatgatgaatttgagataaaatatccccaagtcatggatttgacaata
aagggagaaaaagcaagagccattcttttggaaaagatggcagatatcaaaaaagagttg
tatctttcaatatttttgaatcgttcaaagagatgttatacaattattgcatctgatgag
ggcggtgttgaaattgaatcagtgaaaaaccaaatcatcaaagagatcggattaggtgaa
gtttcagatgatcttgcacaagaagttgcaaaagagatgggactagaaggaaaacacgct
gaaggtgttgtagacactttgaaaaaactatcaaaacttacaattgaaaaagaagcagaa
cttgttgaaattaatccacttgcaattatgcaagacgattcaataactgcactagatgga
aagtttgttacagatgataatagtaactttagacatccagagttagaaaagtatcaagaa
aagtcagagattgaagagcaagctgaaaaaagcggattctcactagttgaattagacgga
gacattgcagtagtaggtaatggtgcaggactggtaatgtctacattagatatgttatca
gataacggaggaaagccagcatgtttcttagatgttggtggcggtgcaacaactgaatca
gtttacgaagcactaactttgattagtaaattagatagagtaaaaggaattttggtaaac
ctctatggaggaattgtaaagactacagtagtagctgaagcatttctcaaagcatatgag
gataacgtaattgacttaccagtattttcaagactaaagggaacagaatcagaaaaagca
acagagatgctgcaaggttctagaaccaaaattttcagtacagttgaagaagcaatcaac
gcagcagtaatgggagtaaagaattga

DBGET integrated database retrieval system