KEGG   Nitrosopumilus maritimus: Nmar_1155Help
Entry
Nmar_1155         CDS       T00626                                 

Definition
ArsR family transcriptional regulator
Organism
nmr  Nitrosopumilus maritimus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1056647..1057015
Genome map
AA seq 122 aa AA seqDB search
MFYLYNIISLIDDMLKMVNDKLELKAKLFRGFGDVTRLAILESVSDGEKTVTEIAEKLKQ
SQPNVSNHLSCLLECGLVKSRKDGKNRFYSIGDKRVAKLLKQSDDILTDIADGIYSCVNY
KK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgttctatttatataatattatatcattaattgatgatatgttaaagatggtaaatgac
aaactggaacttaaagcaaaattgttcagaggtttcggagatgtgacaagattagccatt
ctagaatcagtatcagatggagaaaagacagttacagagattgcagaaaaactaaagcaa
agccaaccaaacgtatctaatcatttgtcctgcttgttagaatgtggtctagtcaagagc
aggaaggatggcaagaatagattttacagtattggagacaaaagagttgccaagcttctc
aaacaaagtgatgatattttgactgacattgcagatggaatctattcctgtgtcaattac
aaaaaataa

DBGET integrated database retrieval system