KEGG   Nitrosopumilus maritimus: Nmar_1193Help
Entry
Nmar_1193         CDS       T00626                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmr  Nitrosopumilus maritimus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nmar_1193
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmar_1193
  Lipid metabolism
   00071 Fatty acid degradation
    Nmar_1193
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmar_1193
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmar_1193
   00626 Naphthalene degradation
    Nmar_1193
Enzymes [BR:nmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmar_1193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1088792..1089826
Genome map
AA seq 344 aa AA seqDB search
MDKMRAMVLSECAAIETNPLKLTEIDRHKIERSNEILLKIEACGVCHSQLHGIEGDWKDL
GIPPQLPTVPGHEVVGKVVEIGSGVTKFKVGDRAGITPLLEACKECQYCKEGKEYLCESS
IILGETLKGGYSEYVTVTEDFATKVPDSMKPEYAAPLFCAGITAYKAVKAAEPQTHKKIG
IFGIGGVGHMAVQFAKVQDCEVIAFSRSQSHLDVAKKLGAIDAIQFSENQEEFLEKLKEK
HGLLDAAIVFAPADIITDTAIRAIKKGGMVVIATIGENPSFVAFEEKTIRGTLIGSTKDM
EEVIKTCNEKNIEVVSEVFPLEDANKVLKKLKDSEIEARAVLIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatgcgtgcaatggtgctgtctgaatgtgcagcaattgagacaaatccacta
aagttaacagaaattgatagacataaaattgaaagatcaaatgaaattttactaaaaatt
gaggcatgtggagtttgccattcacaattacatggaatagaaggtgattggaaagatctt
ggaattccaccacaattaccaacagttccaggacatgaagttgtaggaaaagtagttgag
attggaagtggagttacaaagttcaaagtaggagacagagctggaattacaccattacta
gaagcatgtaaagaatgtcaatattgtaaagaaggaaaagagtacttgtgtgaatcttca
attattctaggtgaaactctcaaaggaggatattcagaatacgtaacagttactgaagac
tttgcaaccaaagtaccagactctatgaaaccagagtatgcagcaccattattttgtgca
ggaattacagcttacaaagcagtaaaagctgcagaaccacaaactcacaaaaaaattgga
atttttggaattggtggagtaggacacatggctgtacagtttgcaaaagtacaagactgt
gaggttattgcattttcaaggtctcaaagtcacctagatgttgcaaagaaactaggggca
attgacgccatacagttttctgaaaatcaagaagaatttttagaaaaattaaaagaaaaa
catggactgcttgatgctgcaattgtttttgcacctgcagacattataacagatactgca
atcagggccataaagaagggaggaatggtagtaattgcgacaattggtgagaatccatct
tttgtagcatttgaagaaaagacaatcagaggaactttgattggttcaactaaagacatg
gaagaagtaatcaagacatgtaatgaaaaaaatatcgaggtagtatctgaagtatttcca
ctagaggatgcaaacaaagttctcaaaaaattaaaagattcagagattgaagctagagca
gttttaattccttaa

DBGET integrated database retrieval system