KEGG   Nitrosopumilus maritimus: Nmar_1447Help
Entry
Nmar_1447         CDS       T00626                                 

Definition
phosphoglucomutase/phosphomannomutase subunit alpha/beta
Organism
nmr  Nitrosopumilus maritimus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1317902..1319200
Genome map
AA seq 432 aa AA seqDB search
MKKTISGIRGIFGEDLYLKDVLEFCNNFSSLVQSGKCAIGKDTRPTGSMMKDAASAALMQ
NGIDVFNLETVPTPVVFREARKYGAGIVVSSSHNPIQWNGLKFIIEGRGINEKELPKIIE
KQEIPKTKIGAEQDISSSYIEDARKIIGSLENNPEVVVDIGGGAAKGFAPELLESIGCKV
HTINENLEGSTRGPDPTADSLSDLVSASSGKDVGFAFDLDGDRLVVVRNGKKQTPDVTLG
LGVAKSLDLGYKKFVLSIDTSVSVEKFIKENGGTVQRTKVGEANVIEQMIKDNAQAGGEG
SSGGFILPEFNYCREGILTSGLISSMLGTAKYNEILDFMESYFQIRDKTAIDAQLHDKVI
EKVQTTFEKNYSETITLDGVKGIIDENSWVLVRKSNTEDIIRVSAESNDENKCKQIVKDT
IELVNQSYEQVR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaacaatttctggaattagaggaatatttggtgaagatctttatcttaaagac
gtactagagttttgtaacaacttttcatcattagtgcagtctggaaaatgcgcaatcgga
aaagataccagacccacaggttccatgatgaaagatgctgcaagtgcagctttaatgcaa
aacggaattgatgtttttaatttagagacagttccaacaccagtagtttttagagaagca
agaaagtatggtgcaggaattgttgtatcatcatctcacaatccaattcaatggaatggt
ttgaagttcatcattgaaggaagaggaatcaatgaaaaagaacttccaaaaattatagaa
aaacaagagattccaaagacaaagattggagcagagcaagacatttcatcatcatacatt
gaggatgcaagaaaaatcataggaagtttggagaacaaccccgaagttgtggtagatatt
ggaggcggtgcggcaaagggatttgcgcctgagttgctagaatcaattggatgtaaggtc
cataccattaatgaaaaccttgaaggttctactagaggccctgatcctactgcagacagt
ttatcagatttggtttcagcatcatcaggaaaagatgttggttttgcatttgacttggat
ggagatagactagttgttgtaagaaatggaaagaaacagacaccagatgtaacattggga
ttgggtgttgcaaagtcgttagatcttggttacaagaaatttgttctaagcattgacact
agtgtttcagttgaaaagttcatcaaagaaaacggtggaactgtacagcgaaccaaagtt
ggtgaagcaaacgtcattgaacagatgataaaagacaatgcacaagctggtggagaagga
agtagtggtggttttattttgcctgagtttaattattgtagagaaggaattctaactagt
ggtttgatttcatcaatgcttggaactgcaaagtacaatgagatactagactttatggaa
agttatttccaaataagagacaagactgcaattgatgcacagttgcacgacaaagtaata
gaaaaagtgcaaacaacatttgagaaaaactattctgaaacaattacacttgatggtgtt
aaagggatcattgatgagaacagttgggtgttggtaagaaaatcaaacactgaagatatc
attagggtttcagctgaatcaaatgatgagaacaagtgcaaacaaattgtaaaagataca
atagagttggtgaatcaaagttatgagcaagttagatga

DBGET integrated database retrieval system