KEGG   Nitrosopumilus maritimus: Nmar_1570Help
Entry
Nmar_1570         CDS       T00626                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
nmr  Nitrosopumilus maritimus
Pathway
nmr00790  Folate biosynthesis
nmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmar_1570
Enzymes [BR:nmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Nmar_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABX13466
UniProt: A9A5Y8
Position
complement(1437892..1438737)
Genome map
AA seq 281 aa AA seqDB search
MTRIAKVGVGGKNPVRIMGILNTSPESFYKKSIQTTKTQIKNSIKEMENDGVDFIDVGGM
STAPYLSTMVSEKTESKRILEAVKIIQDVSNIPISVDTCRAKPARDALENGVEIINDISG
LKYDEKMKDVISDFSPSLILCAFSSKTVTGNLMSTKKLLQESLKIAKKSHVPSEKIVLDP
SIGFFRKKGNGPFFTKIKSDWVKRDLTIIQNLNSIKGNYPVLISVSNKSFLGEILQKDPS
DRLFGSIAAEAISVVNGADIIRTHNVNATKDAITIASNLKK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgactagaattgcaaaagtgggtgttggaggtaaaaatccagttcgcatcatgggtatt
ttgaacactagtcctgagtcattttataaaaaatctattcaaactactaaaactcagata
aagaattctattaaagaaatggaaaatgatggtgtagattttatcgatgtaggtggaatg
tctactgcaccctatctttctactatggtatctgaaaaaactgaatcaaagagaatactt
gaagcagtaaaaattattcaagatgtatctaatattccaatatctgttgatacatgtagg
gcaaaacctgctagagatgccttagagaatggtgtggaaatcatcaatgatatttctggt
ttaaaatatgatgaaaaaatgaaagatgtaatttcagatttttcgccatcattaatcttg
tgtgcttttagttcaaaaaccgtaacgggcaatcttatgtctacaaaaaaattacttcaa
gaaagcttgaagattgcaaaaaaatctcatgtgccctctgaaaaaattgtgttagatcct
tcaattggattttttagaaaaaaaggaaacggaccatttttcaccaaaatcaaatctgat
tgggttaaaagagatctaactataatccaaaatttgaattctatcaaaggaaactatcca
gttttgatctcagtttcaaacaaatcctttcttggagaaattttacaaaaagatccatct
gatcgcttgtttggatctattgctgctgaagcaatatctgtagttaatggtgcagacatt
atacgtacacataacgtaaatgctacaaaagatgcaataacaatagcatcaaacctgaaa
aaataa

DBGET integrated database retrieval system