KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0011Help
Entry
NMBM01240355_0011 CDS       T01947                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nms00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nms00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7539..8792)
Genome map
AA seq 417 aa AA seqDB search
MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVPMLADVKTTQKLLQGM
GARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLARFGEAQVSLPGGCAIG
SRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTVGGTENLLMAATLAEGTT
VLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGVDELHGCEHSVVPDRIEAGTFLC
AVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIAIDMRQRPKAVDIRTVVHPG
FPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRMGANITTEGNTAFVQGVEQLS
GAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYENIEKKLGSVGAKIERVSG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactgaaaatctccgcaaacggcccgctcaacggggaaataacggtctcgggc
gcgaaaaacgcggcattgccgctgatgtgcgcgggtttgctgacatcgggtacgttgcgc
ctgaaaaacgtccctatgctggcagatgtgaaaaccacgcaaaagctgcttcaggggatg
ggcgcgcgcgtcctgactgacaatatcagcgaatttgaaatcaacggcggtacggtaaac
aatacctgcgccccttacgaattggtacggacgatgcgggcctcgattttggtgctgggg
cctactttggcacgtttcggcgaggcgcaagtcagcctgccgggcggctgcgccatcggt
tcgcgccccgtcgatcagcatttgaaaggcttggaagcgatgggtgctgagattgttatc
gaacacggttacgtcaaagccaaaggcaaactcaaaggtacgcgcgtggcgatggatgtc
gttaccgtcggcggcacggaaaacctgctgatggcggcgacgctggcggaaggtacgacg
gttttggaaaactgcgccattgagcctgaagtggtcgatttggcggaatgcctggtcaaa
atgggcgcgaaaatcagcggcatcggtacgtccacaatgattgtggaaggtgtggacgag
ctgcacggctgcgaacacagcgtcgtccccgaccggattgaagcggggacgttcctgtgt
gcggtggcgataaccggcggcagggtggttttgcggaatgctgcgccgaaaacgatggaa
gtggtgttggacaaactggttgaggcaggtgcggtgattgaggcgggcgatgattggatc
gccatcgatatgcggcagcgtccgaaggcggtggacatccgcacggtcgtccaccccggc
ttccccacggatatgcaggcgcagtttatggcattgaatgccgtggcggagggaagctgc
cgcgtggtggaaacgatttttgaaaaccgctttatgcacgtccccgagttgaaccggatg
ggggcgaacatcacaaccgagggcaatacggcatttgtgcagggtgtggaacagctttcc
ggcgcggtcgtcaaggcgacggatttgcgtgcgtccgcaagcctcgttatcgccggtttg
gcggcgcgcggcgaaaccgtggtcgaacagatttaccacttggatcgcggttatgaaaat
attgaaaaaaaactcggcagcgtcggcgcgaaaatcgagcgcgtatccggctga

DBGET integrated database retrieval system