KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0064Help
Entry
NMBM01240355_0064 CDS       T01947                                 

Gene name
rfbC1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMBM01240355_0064 (rfbC1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM01240355_0064 (rfbC1)
Enzymes [BR:nms01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMBM01240355_0064 (rfbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(70682..71239)
Genome map
AA seq 185 aa AA seqDB search
MNIIDTALPDVKLLKPQVFTDGRGFFMETFRDGWFKTQVCERTFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMRKDSPTFGKWVGEILSAENKRQLWVPEGFAHGFY
VLSDTTELTYKCTDYYKPEAEHSLIWNDPTVGIGWPLQTAPLLSPKDLAGKTWAQAEKLR
LTLSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcgacaccgccctccccgacgtaaaacttttaaaaccgcaagtcttcaca
gacgggcgcggcttttttatggaaaccttccgcgacgggtggtttaaaacccaagtctgc
gaacgcaccttcgtgcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtagttgtcggcgaagtgttc
gacgtggccgtcgatatgcgtaaagactcccccactttcggcaaatgggtaggcgagatt
ctgtccgcagaaaacaaacgccaactgtgggtacccgaaggtttcgcgcacgggttttac
gttttgagcgacacgaccgaacttacctacaaatgcacggactattacaagcctgaagcc
gaacactcactaatttggaatgatccgaccgtcggcataggctggccgcttcaaaccgcg
ccgctgctgtcgcccaaagaccttgccggcaaaacgtgggcgcaagccgaaaagctccgc
cttacactttcccgataa

DBGET integrated database retrieval system