KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0103Help
Entry
NMBM01240355_0103 CDS       T01947                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nms00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nms00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115944..116864
Genome map
AA seq 306 aa AA seqDB search
MPNPLYRQHIISISDLSREQLECLLQTALKLKAHPRGDLLEGKLIGSCFFEPSTRTRLSF
ETAVQRLGGKVIGFSDGANTSAKKGETLADTARIISGYTDAIIQRHPKDGAARVAAEFSR
VPVINAGDGTNQHPSQTLLDLVTIYETQGRLDKLKIAMAGDLKYGRTVHSLCQALKRWGC
EFAFVSPPSLAMPDYITEELDEVGCRYRILGSLEEAAEWADILYMTRVQRERFDEQEFAK
IQGKFNLEASMLARAKPNLRVLHPLPRVDEIHPDVDATPHAYYFEQATNGVYARMAILSL
VLNEEV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatccgctttacagacagcacatcatctcgatttcggatttgtcgcgcgaacag
ttggaatgcctgcttcagacggcattgaagctgaaggcgcatccgcgcggcgatttgttg
gaaggcaaacttatcggttcgtgtttctttgaaccgtccacgcgcacgaggctgtcgttt
gaaacggcggtgcagcggctgggcggcaaggtcatcggcttttcggacggcgcgaatacc
agtgccaaaaaaggcgagacgcttgccgataccgcccgcatcatttccggctacaccgac
gcaatcatccaacgccaccccaaagacggcgcggcgcgcgtggcagcggagttttcgcgc
gtccccgtcatcaacgccggcgacggcaccaaccagcaccccagccagaccttgttggat
ctggtaacgatttatgaaacgcaggggcgtttggacaagctcaaaatcgccatggcgggc
gacttgaaatacgggcgcaccgtgcattcgctttgtcaggcgttgaaacgctggggctgc
gaatttgcctttgtttcgccgcccagcctggccatgcccgactacattaccgaagagctg
gacgaagtcggctgccgataccgtatcctcggcagtttggaagaggcggcggaatgggcg
gatatcctgtatatgacccgcgtccagcgcgaacgtttcgacgaacaggaatttgccaaa
atccaaggcaaattcaacctcgaagcgtctatgcttgcccgcgccaaaccgaacctgcgc
gtgctgcaccctttgccgcgcgtggacgaaatccatcccgatgtcgatgccacgccgcat
gcctattatttcgagcaggcgaccaacggcgtttatgcgcgtatggcgatattgtcgctg
gtgttgaacgaagaagtgtga

DBGET integrated database retrieval system