KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0395Help
Entry
NMBM01240355_0395 CDS       T01947                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nms00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nms00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408111..409121
Genome map
AA seq 336 aa AA seqDB search
MSDTPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVRENLVVSFDD
AASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHGLAVTRFNAV
AADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDDRLTVSYRATALGDTVFDPTLHIYW
RLDAGLHDAVLHIPQGGHIPADAEKLPVSTVSDDLEVFDFSRPKPLDAAVAALRRETGRA
GFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATE
AQTLPDSLNWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccgcgatttcggcctgatcgacgggcgtgccgtaaccggc
tatgtgctgtccaaccggcgtggtacgcgtgtctgcgtgctggacttgggcgggattgtg
caggaattttccgttttggcagacggcgtgcgcgaaaacctcgtggtgtcgttcgacgat
gcggcttcctatgcggacaatccgtttcagattaacaagcagatagggcgcgtggccgga
cgcatccgcggtgcggcgttcgacatcaacggcaggacttaccgcgtggaggccaacgaa
ggcaggaacgcgctgcacggcggttcgcacgggctggccgttacccgtttcaacgcggtg
gcggcagacggccgttcggtggtgctgcgcagccgcctgcaacagtcggccgacggttat
cccaacgatttggatttggatatttcctaccgcttggacgaggacgaccggcttaccgtt
agctatcgcgccaccgcgctcggcgacacggtgttcgacccgacgctgcacatttactgg
cggctggacgcgggcctgcacgatgcggttctgcatattccgcagggcggacatattccg
gccgatgccgaaaaactgcccgtctcaacggtttcagacgacctcgaagtatttgatttc
agccggcccaagccgctggatgccgccgttgccgccctgcgccgcgaaacgggtcgggcc
ggttttgacgacgcttaccgcgtgccgtccgatataggccgtcccgccgctgtgttgcaa
gccggacgccgccgtcgtatcagcatatacagcgaccgcaacggcttggtcatctttacc
gccgccccgcaggatttcgcgcggcacgatgcgggcgtttacgacgcgctggcgaccgag
gcgcagacgctgcccgacagcctgaattggcccgagttcggcaatattcgtctgaacaag
ggtgatactagggaggcgacgattgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system