KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0676Help
Entry
NMBM01240355_0676 CDS       T01947                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nms01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nms00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nms00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735028..735813
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALNGEKALIPYITVGDPDIGATLAIMHSMVANGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIEN
NAGNEAAAVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttaaacggtgaaaaggcattgattccttat
attacggttggagacccggatattggggcgactttggcaataatgcacagtatggttgca
aacggtgcggatattttagagttgggcgtgccgttttccgatccgatggcggacgggccg
gtgattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgacgcggtcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgcggccgtcggtgctttggtcaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system