KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_0953Help
Entry
NMBM01240355_0953 CDS       T01947                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00020  Citrate cycle (TCA cycle)
nms00310  Lysine degradation
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01120  Microbial metabolism in diverse environments
nms01130  Biosynthesis of antibiotics
nms01200  Carbon metabolism
Module
nms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240355_0953 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMBM01240355_0953 (sucB)
Enzymes [BR:nms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBM01240355_0953 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADY99480
Position
1008786..1009970
Genome map
AA seq 394 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAAPAEATPAAAAPDAAQNNAAMPAAAKLAAET
GVDVNALQGSGRDGRVLKEDVQNAAAKPAAASAPAVALPAGARPEERVPMSRLRARVAER
LLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPV
VNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKI
AIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLA
LSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgattgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcccctgccgccgcgcctgccgaagctaccccagccgccgccgct
cctgatgctgcacaaaacaacgccgctatgcctgctgccgccaaactggctgccgagacc
ggtgttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagac
gtacaaaatgccgcagccaaacctgccgcagcctctgctcctgccgttgcacttcctgcc
ggcgcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgc
ctcttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaa
ccaatcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaa
ttgggctttatgtctttcttcgttaaagccgctgttgccgccctgaaaaaatacccggtt
gtgaatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgacatcggtatc
gcaattggcagcccacgcggtttggttgtaccaatcctgcgtgatgccgaccaaatgagc
attgccgacatcgagcaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatc
gctatcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttct
atgatgtctaccccgatcatcaacccgcctcaatctgcgattttgggtatgcacgccact
aaagagcgcgctgtggttgaaaacggccaagttgttgtccgtccaatgatgtatctggct
ctgtcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccatt
aaagacgcgttggaagacccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system