KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1324Help
Entry
NMBM01240355_1324 CDS       T01947                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00010  Glycolysis / Gluconeogenesis
nms00052  Galactose metabolism
nms00500  Starch and sucrose metabolism
nms00520  Amino sugar and nucleotide sugar metabolism
nms00521  Streptomycin biosynthesis
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01120  Microbial metabolism in diverse environments
nms01130  Biosynthesis of antibiotics
nms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240355_1324 (glk)
   00052 Galactose metabolism
    NMBM01240355_1324 (glk)
   00500 Starch and sucrose metabolism
    NMBM01240355_1324 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM01240355_1324 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM01240355_1324 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NMBM01240355_1324 (glk)
Enzymes [BR:nms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMBM01240355_1324 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADY99835
Position
complement(1402445..1403431)
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGTSPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcgga
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcacgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgcggcggcattattccccgcgtgttggaatacttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
cttgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system