KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1404Help
Entry
NMBM01240355_1404 CDS       T01947                                 

Definition
(GenBank) aminotransferase, classes I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
nms00220  Arginine biosynthesis
nms00250  Alanine, aspartate and glutamate metabolism
nms00290  Valine, leucine and isoleucine biosynthesis
nms01100  Metabolic pathways
nms01110  Biosynthesis of secondary metabolites
nms01130  Biosynthesis of antibiotics
nms01210  2-Oxocarboxylic acid metabolism
nms01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMBM01240355_1404
   00290 Valine, leucine and isoleucine biosynthesis
    NMBM01240355_1404
   00220 Arginine biosynthesis
    NMBM01240355_1404
Enzymes [BR:nms01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NMBM01240355_1404
    2.6.1.66  valine---pyruvate transaminase
     NMBM01240355_1404
Amino acid related enzymes [BR:nms01007]
 Aminotransferase (transaminase)
  Class I
   NMBM01240355_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADY99912
Position
complement(1510152..1511366)
Genome map
AA seq 404 aa AA seqDB search
MDKFPKSAKLDHVCYDIRGPVHKKALQLEEEGNKILKLNIGNPAPFGFEAPDEILVDVIR
NLPTSQGYCDSKGLYSARKAIVHYYQTKGLRDITVDDVYIGNGVSELITMSMQALLDDGD
EILIPAPDYPLWTAAATLAGGTVRHYLCDEENGWFPNLADMEAKITPKTKAIVVINPNNP
TGAVYSREILLEIAELARKHGLIIFADEIYDKILYDGAVHHHIAALAPDLLTVTFNGLSK
SYRVAGFRQGWMVLNGPKHHAKGYIEGLDMLSSMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNRAWELVSQIPGVSCVKPMGAMYMFPKIDTEMYRIRDDMKFVYDLLVREK
VLLVQGTGFNWIKPDHFRIVTLPYVHQIEEAMGRLARFLQTYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcccaagtctgcaaagctcgatcacgtctgttacgacatacgcgggccg
gttcacaaaaaagcccttcagttggaagaggagggcaataaaatccttaaactcaatatc
ggcaaccctgcgccgttcggctttgaagcccctgatgaaatcttggtcgatgtcatccgc
aacctgccgacttcgcaaggctattgcgattctaaagggctgtattccgcccgcaaagcc
attgttcactactatcagaccaaaggtttgcgcgatattacggttgatgatgtctatatc
ggcaacggcgtgtccgagctgattacgatgtctatgcaggcattgctcgacgacggcgac
gaaatcctgattcccgcgcccgactaccctttgtggacggcggcggcaacgcttgcgggc
ggtacggtacgccattatctgtgcgacgaagaaaacggctggttccccaaccttgccgat
atggaagccaaaatcacgcccaaaaccaaagccatcgtcgtcatcaatcccaataatccg
acaggcgcggtgtacagcagggaaatcctgttggaaatcgccgaactggcgcgcaagcac
ggtttgattattttcgccgacgagatttacgataaaatcctttatgacggcgcggttcac
caccacatcgccgcgcttgcccccgaccttttgacggtaacgttcaacggtttgtccaaa
tcctaccgcgtcgccggcttccgccaaggctggatggtgctcaacgggccgaaacatcac
gcaaaaggttacatcgagggtttggatatgctctcgtccatgcgcttgtgtgccaatacg
ccgatgcagcacgcgattcagacggcattgggcggctatcagagcattaacgaatttatc
ctgccgggcgggcggcttttggaacagcgcaacagggcgtgggaactggtcagccaaatc
cccggcgtgtcctgcgtcaaaccgatgggcgcgatgtatatgttcccgaaaatcgatacc
gaaatgtaccgcatccgcgatgacatgaaattcgtttacgatttgctggtgcgcgaaaaa
gtcttgctggtacagggaacggggtttaattggattaaacctgaccatttccgcattgtc
acgctgccttacgtccatcagattgaagaggcgatgggcaggttggcaagattcctgcaa
acctaccgccaataa

DBGET integrated database retrieval system