KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1551Help
Entry
NMBM01240355_1551 CDS       T01947                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nms00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMBM01240355_1551
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMBM01240355_1551
Enzymes [BR:nms01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMBM01240355_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1678758..1679357)
Genome map
AA seq 199 aa AA seqDB search
MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLT
PQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVN
GANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVE
RFAPSVTPEEIEADIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctttcatgccgtctgaagcacgtttcagatggcatcggtttacatcagataagg
ataaaaatgggtatttacgattttcaaatgaaagatgcggaaggcaatgcggttgatttg
tcaggctatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgacc
ccgcaatacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagatt
ttggattttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcc
caagtgtgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaat
ggagcaaataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggc
aatcatctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaa
ggcgacatcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgag
cgttttgcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system