KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1814Help
Entry
NMBM01240355_1814 CDS       T01947                                 

Definition
putative protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1996240..1996896)
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRERFVDASLQGLAYADTELPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYAAALLAKLAGRVVSDDIDAEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNIVPDVLKEQLKDGGRMVVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDADPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgatgtgttggacgctttggcggagattccgcgcgagcgtttcgtggatgcg
tctttgcagggtttggcgtatgcggatacggagctgccgcttgccaacgggcataagatg
ctcgagccgaaagtcgtggcgcggttggcgcaaggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggatcgggctatgctgccgcgctgttggcgaagctggcgggc
agggtggtgtcggacgatatcgatgcggaacagcaaaaccgcgccaaagcggtgttggac
ggtttgggtttggacaatatcgattatgtgcaaaacaacgggctgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtcaatattgtgcctgatgtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system