KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_1814Help
Entry
NMBM01240355_1814 CDS       T01947                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Brite
Enzymes [BR:nms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMBM01240355_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 CMAS Methyltransf_11 RrnaAD Methyltransf_18 Methyltransf_12 Ubie_methyltran Methyltransf_23 MTS Methyltransf_9 Methyltransf_3 DUF938 Methyltr_RsmB-F Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ADZ00293
Position
complement(1996240..1996896)
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRERFVDASLQGLAYADTELPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYAAALLAKLAGRVVSDDIDAEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNIVPDVLKEQLKDGGRMVVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDADPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgatgtgttggacgctttggcggagattccgcgcgagcgtttcgtggatgcg
tctttgcagggtttggcgtatgcggatacggagctgccgcttgccaacgggcataagatg
ctcgagccgaaagtcgtggcgcggttggcgcaaggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggatcgggctatgctgccgcgctgttggcgaagctggcgggc
agggtggtgtcggacgatatcgatgcggaacagcaaaaccgcgccaaagcggtgttggac
ggtttgggtttggacaatatcgattatgtgcaaaacaacgggctgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtcaatattgtgcctgatgtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system