KEGG   Neisseria meningitidis M01-240355 (serogroup B): NMBM01240355_2091Help
Entry
NMBM01240355_2091 CDS       T01947                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nms  Neisseria meningitidis M01-240355 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:nms00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281942..2282568)
Genome map
AA seq 208 aa AA seqDB search
MIVSIDVDAQKTFTPLCPDELPVNEGHLIVEELNAQAALADLRVMTKDAHHMAAKWLVDN
PVDMLKPTGLPDADLTWVAHAMIGTHGYELLDGLPSAKEYDYCVWKGVDPELHPYGACFH
DIEEKLSTGLIEWLRCQHTDTVIVGGLATDYCVKTTVLQLLKGGNWQVIVNEAACRGIAP
ETIETAWQEMRSAGAIILKNAEEIKKIY
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacttttacgcctttgtgtcctgacgag
ctgcctgtgaacgaggggcatttgattgttgaagagttgaatgcccaagccgctttggcg
gatttgcgcgtgatgacgaaagatgcgcatcatatggcggcgaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttgcctgatgcggatttgacttgggtggctcat
gcaatgatcggtacgcacggctatgaattgttggacgggctgccttctgctaaagaatac
gattattgcgtttggaaaggtgttgatcccgaattgcatccttacggcgcgtgttttcac
gatattgaagaaaaactgagcacggggttgattgaatggctgcgttgtcaacatacggat
acggtcattgtcggcggattggcaacggattattgtgttaaaacaacggttttgcagttg
ctcaaaggcggcaattggcaggttatcgtcaatgaagcggcttgtcggggcattgcgccg
gaaaccatcgaaacggcatggcaggaaatgcgttctgccggtgcaattatcttaaaaaac
gctgaagaaattaaaaaaatatattaa

DBGET integrated database retrieval system