KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0012Help
Entry
NMV_0012          CDS       T01928                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase; UDP-N-acetylglucosamine enolpyruvyl transferase; EPT) (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmt00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nmt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7537..8790)
Genome map
AA seq 417 aa AA seqDB search
MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVPMLADVKTTQKLLQGM
GARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLARFGEAQVSLPGGCAIG
SRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTVGGTENLLMAATLAEGTT
VLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGADELHGCEHSVVPDRIEAGTFLC
AVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIAIDMRQRPKAVDIRTVVHPG
FPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRMGANITTEGNTAFVQGVEQLS
GAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYENIEKKLGSVGAKIERVSG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactgaaaatctccgcaaacggcccgctcaacggggaaataacggtctcgggc
gcgaaaaacgcggcattgccgctgatgtgcgcgggtttgctgacatcgggtacgttgcgc
ctgaaaaacgtccctatgctggcagatgtgaaaaccacgcaaaagctgcttcaggggatg
ggcgcgcgcgttctgaccgacaatatcagcgaatttgaaattaacggcggcacggtaaac
aatacctgcgcgccttacgaattggtacggacgatgcgggcctcgattttggtgctgggg
cctactttggcacgtttcggcgaggcgcaagtcagcctgccgggcggctgcgccatcggt
tcgcgccccgtcgatcagcatttgaaaggcttggaagcgatgggggcggaaatcgtcatc
gaacacggttacgtcaaggctaagggtaaactcaaaggtacgcgcgtggcgatggatgtc
gttaccgtcggcggcacggaaaacctgctgatggcggcgacgctggcggaaggtacgacg
gttttggaaaactgcgccattgagcctgaagtggtcgatttggcggaatgcctggtcaaa
atgggcgcgaaaatcagcggcatcggtacgtccacaatgattgtggaaggtgcggacgag
ctgcacggctgcgaacacagcgtcgtccccgaccggattgaggcggggacgttcctgtgc
gcggtggcgataaccggcggcagggtggttttgcggaatgccgcgccgaaaacgatggaa
gtggtgttggacaaactggttgaggcaggtgcggtgattgaagcgggcgacgattggatc
gccatcgatatgcgtcagcgtccgaaggcggtggacatccgcacggtcgtccaccccggc
ttccccacggatatgcaggcgcagtttatggcattgaatgccgtggcggagggaagctgc
cgcgtggtggaaacgatttttgaaaaccgctttatgcacgtccccgagttgaaccggatg
ggggcgaacatcacaaccgagggcaatacggcatttgtgcagggggtggaacagctttcc
ggcgcggtcgttaaggcgacggatttgcgtgcgtccgcaagcctcgttatcgccggtttg
gcggcgcgcggcgaaaccgtggtcgaacagatttaccacttggatcgcggttatgaaaat
attgaaaaaaaactcggcagcgtcggcgcgaaaatcgagcgcgtatccggctga

DBGET integrated database retrieval system