KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0012Help
Entry
NMV_0012          CDS       T01928                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase; UDP-N-acetylglucosamine enolpyruvyl transferase; EPT) (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMV_0012 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMV_0012 (murA)
Enzymes [BR:nmt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NMV_0012 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7537..8790)
Genome map
AA seq 417 aa AA seqDB search
MDKLKISANGPLNGEITVSGAKNAALPLMCAGLLTSGTLRLKNVPMLADVKTTQKLLQGM
GARVLTDNISEFEINGGTVNNTCAPYELVRTMRASILVLGPTLARFGEAQVSLPGGCAIG
SRPVDQHLKGLEAMGAEIVIEHGYVKAKGKLKGTRVAMDVVTVGGTENLLMAATLAEGTT
VLENCAIEPEVVDLAECLVKMGAKISGIGTSTMIVEGADELHGCEHSVVPDRIEAGTFLC
AVAITGGRVVLRNAAPKTMEVVLDKLVEAGAVIEAGDDWIAIDMRQRPKAVDIRTVVHPG
FPTDMQAQFMALNAVAEGSCRVVETIFENRFMHVPELNRMGANITTEGNTAFVQGVEQLS
GAVVKATDLRASASLVIAGLAARGETVVEQIYHLDRGYENIEKKLGSVGAKIERVSG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactgaaaatctccgcaaacggcccgctcaacggggaaataacggtctcgggc
gcgaaaaacgcggcattgccgctgatgtgcgcgggtttgctgacatcgggtacgttgcgc
ctgaaaaacgtccctatgctggcagatgtgaaaaccacgcaaaagctgcttcaggggatg
ggcgcgcgcgttctgaccgacaatatcagcgaatttgaaattaacggcggcacggtaaac
aatacctgcgcgccttacgaattggtacggacgatgcgggcctcgattttggtgctgggg
cctactttggcacgtttcggcgaggcgcaagtcagcctgccgggcggctgcgccatcggt
tcgcgccccgtcgatcagcatttgaaaggcttggaagcgatgggggcggaaatcgtcatc
gaacacggttacgtcaaggctaagggtaaactcaaaggtacgcgcgtggcgatggatgtc
gttaccgtcggcggcacggaaaacctgctgatggcggcgacgctggcggaaggtacgacg
gttttggaaaactgcgccattgagcctgaagtggtcgatttggcggaatgcctggtcaaa
atgggcgcgaaaatcagcggcatcggtacgtccacaatgattgtggaaggtgcggacgag
ctgcacggctgcgaacacagcgtcgtccccgaccggattgaggcggggacgttcctgtgc
gcggtggcgataaccggcggcagggtggttttgcggaatgccgcgccgaaaacgatggaa
gtggtgttggacaaactggttgaggcaggtgcggtgattgaagcgggcgacgattggatc
gccatcgatatgcgtcagcgtccgaaggcggtggacatccgcacggtcgtccaccccggc
ttccccacggatatgcaggcgcagtttatggcattgaatgccgtggcggagggaagctgc
cgcgtggtggaaacgatttttgaaaaccgctttatgcacgtccccgagttgaaccggatg
ggggcgaacatcacaaccgagggcaatacggcatttgtgcagggggtggaacagctttcc
ggcgcggtcgttaaggcgacggatttgcgtgcgtccgcaagcctcgttatcgccggtttg
gcggcgcgcggcgaaaccgtggtcgaacagatttaccacttggatcgcggttatgaaaat
attgaaaaaaaactcggcagcgtcggcgcgaaaatcgagcgcgtatccggctga

DBGET integrated database retrieval system