KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0060Help
Entry
NMV_0060          CDS       T01928                                 

Gene name
rfbC1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase; dTDP-L-rhamnose synthetase) (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMV_0060 (rfbC1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMV_0060 (rfbC1)
Enzymes [BR:nmt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMV_0060 (rfbC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67363..67920)
Genome map
AA seq 185 aa AA seqDB search
MNIIDTALPDVKILKPQVFKDGRGFFMETFRDGWFKENIADCSFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWTGATLSAQNQYQLWIPEGFAHGFY
VLGDAAEVVYKCTDYYNPKAEHSLIWNDPTVGIDWPLQGEPNLSPKDLAGKAWAQAEKLR
LTLSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcgacaccgccctccccgacgtaaaaattttaaaaccgcaagtcttcaaa
gacgggcgcggcttttttatggaaaccttccgcgacgggtggttcaaagaaaatattgcc
gactgttcctttgttcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtggttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatggacaggcgcaacc
ctgtcggcacaaaaccaataccagctttggatacccgaaggcttcgcgcacgggttttac
gttttgggagacgcggcggaagtcgtgtacaaatgcacggactattacaaccccaaagcc
gaacactcgctgatttggaatgatccgaccgtcggcatcgactggccgctacaaggcgag
ccgaacctgtcgcctaaagatcttgccggtaaagcgtgggcgcaagccgaaaagctccgc
cttacgctttcccgataa

DBGET integrated database retrieval system