KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0085Help
Entry
NMV_0085          CDS       T01928                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (dTDP-4-keto-6-deoxyglucose 3,5-epimerase; dTDP-L-rhamnose synthetase) (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:nmt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nmt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
88831..89370
Genome map
AA seq 179 aa AA seqDB search
MNIIDTALPDVKILKPQVFKDGRGFFMETFRDGWFKENIADCSFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWTGATLSAQNQYQLWIPEGFAHGFY
VLGDAAEVVYKCTDYYNPKAEHSLIWNDPTVGIDWPLQGEPNLSPKDLAGKVLAEAVTF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatcgacaccgccctccccgacgtaaaaattttaaaaccgcaagtcttcaaa
gacgggcgcggcttttttatggaaaccttccgcgacgggtggttcaaagaaaatattgcc
gactgttcctttgttcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtggttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatggacaggcgcaacc
ctgtcggcacaaaaccaataccagctttggatacccgaaggcttcgcgcacgggttttac
gttttgggagacgcggcggaagtcgtgtacaaatgcacggactattacaaccccaaagcc
gaacactcgctgatttggaatgatccgaccgtcggcatcgactggccgctacaaggcgag
ccgaacctgtcgcctaaagacttggccggcaaagtattggctgaagcggtcacgttttaa

DBGET integrated database retrieval system