KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0515Help
Entry
NMV_0515          CDS       T01928                                 

Gene name
speB
Definition
agmatinase (agmatine ureohydrolase; AUH) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMV_0515 (speB)
Enzymes [BR:nmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NMV_0515 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507123..508046
Genome map
AA seq 307 aa AA seqDB search
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSGRSGARFGPEA
IRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDSRDFVEKMEAHAGKLLSSGKR
CLSLGGDHFITLPLLRAHARYFGKLALIHFDAHTDTYDNGSEYDHGTMFYTAPKEGLIDP
SRSVQIGIRTEHSKKLPFTVLTAPQVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSF
APGTGTPVCGGLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagcacactggcaggacaaaccgacaactccctcgtttccaataatttcggg
tttttgcgcctgccgcttaattttatgccgtatgaaagtcatgccgattgggttattacc
ggcgtgccttatgatatggcggtttcagggcgttccggcgcgcgtttcggtcctgaagcc
atccggcgcgcctccgtcaacctcgcttgggagcaccgcaggtttccatggacatttgat
gtgcgcgaacgcctgaacattattgattgcggcgacttggttttttcttttggcgacagc
agggattttgtcgaaaaaatggaagcgcacgccggcaaattactttcttccggcaaacgc
tgtttgagtttgggcggcgaccatttcattaccctcccgttgttgcgcgcccacgcccgc
tatttcggcaaactcgcactgattcattttgacgcgcacaccgacacctacgacaacggc
agcgaatacgaccacggtacgatgttctataccgcccccaaggaaggcctcatcgacccg
tcccgttccgtgcaaatcggcatacgtaccgaacacagtaaaaaattgccttttactgtg
ttgaccgccccccaagtcaatgaagacagtgttgaagagaccgtccgtaaaatcaaagaa
accgtcggcaatatgcccgtttacctgactttcgacatagactgcctcgacccgtcgttc
gcccccgggaccggtacgcccgtatgcggcggcttgagcagcgacagggcattaaaaatc
ctacgtgggctgacggatctcgacatcgtcggtatggatgttgtagaagttgccccctct
tacgaccaatccgacattaccgctttggccggcgccacaattgccttggaaatgctttac
cttcaaggtgcgaaaaaggactga

DBGET integrated database retrieval system