KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0679Help
Entry
NMV_0679          CDS       T01928                                 

Gene name
folP
Definition
dihydropteroate synthase (DHPS; dihydropteroate pyrophosphorylase) (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMV_0679 (folP)
Enzymes [BR:nmt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NMV_0679 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660377..661228
Genome map
AA seq 283 aa AA seqDB search
MARHVWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAQTALAHAERLLKEGADILD
IGGESTRPGADYVSPEEEWARVEPVLVEVAGWGVPVSLDTRRTVVMEKALALGGIDIIND
VAALTDEGAVELLAHQTDTGICLMHMQGLPENMQINPKYQDVVGEVARYLKARATECIAA
GIAPQRITLDPGFGFGKTLQHNIALMRHLPELMAETGFPLLIGVSRKRMIGELTGETDAA
ARVHGSVAAALASVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacgtttggcaggcaggacggtttgaaatcggtttggacaaaccgaaaatc
atgggtatcgtgaatctcacgcccgattctttttccgacggcggcgcgtattcacaaaac
gcccaaacagctttggcgcatgccgaacggcttttgaaagagggtgcggacattctcgac
atcggcggcgaatcgacgcggccgggtgcggattatgtttcgcctgaagaagaatgggcg
cgggttgaacctgtattggtggaagtggcggggtggggcgttcccgtcagtttggacacg
cgccgcacggtggttatggaaaaagcgttggcactcggcggcatcgatattattaacgat
gtggcggcgttgaccgacgaaggcgcggtcgaattgctagcgcaccagacggacacgggt
atttgcctgatgcacatgcagggtttgcctgaaaacatgcagattaatccgaaatatcag
gatgttgtcggtgaagtggcgcggtatttgaaagcgcgggcgacggaatgcatcgcggca
ggcatcgccccgcaacgcatcacactcgaccccggtttcggtttcggcaaaaccttacaa
cacaatatcgcactgatgcggcatttacccgaattgatggcagaaacaggctttccgctg
ctgatcggcgtatcgcgcaaacgcatgataggcgagctgaccggcgaaaccgacgcggcg
gcgcgcgtacacggcagcgtggcggcggcgctggcttccgtggcgcgcggcgcgcaaatc
gtgcgggtgcatgacgtgaaggcgacggcggacgcgttgaaggtgtgggaagcgttgggc
atcaatctgtaa

DBGET integrated database retrieval system