KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0754Help
Entry
NMV_0754          CDS       T01928                                 

Definition
putative phospholipid hydroperoxide glutathione peroxidase (PHGPx) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nmt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nmt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
741402..741935
Genome map
AA seq 177 aa AA seqDB search
MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILD
FPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNH
LFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttgtcaggc
tatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgaccccgcaa
tacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagattttggat
tttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcccaagtg
tgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaatggagca
aataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggcaatcat
ctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaaggcgac
atcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgagcgtttt
gcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system